Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
posterior fossa group B ependymoma 1530 5.4e-09


  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 2.200 5.4e-09

Gene RIF (1)

27100087 RNA-seq evidence of biallelic expression of LCA5L and 10 neighboring genes in at least one primary human tissue tested indicates that the expression of LCA5L is uncoupled from the control of the maternally inherited 5mCpG imprints at the WRB differentially methylated region (DMR) in disomic controls or trisomy (Down syndrome) individuals.

AA Sequence

SHPLPPSQASTSHAFGDSKVTVVNSIKPSSPTEGKRKIII                                  631 - 670

Text Mined References (6)

PMID Year Title
27100087 2016 Trisomy 21 Alters DNA Methylation in Parent-of-Origin-Dependent and -Independent Manners.
25416956 2014 A proteome-scale map of the human interactome network.
17546029 2007 Mutations in LCA5, encoding the ciliary protein lebercilin, cause Leber congenital amaurosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.