Property Summary

NCBI Gene PubMed Count 49
PubMed Score 1003.75
PubTator Score 268.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.517 6.4e-03
chronic lymphocytic leukemia -1.144 8.1e-03
astrocytoma 1.200 1.2e-21
glioblastoma 1.700 1.8e-08
oligodendroglioma 1.300 4.8e-14
osteosarcoma -2.657 2.6e-06
posterior fossa group A ependymoma 1.500 4.3e-10
group 3 medulloblastoma 2.300 9.3e-06
atypical teratoid/rhabdoid tumor 1.500 7.2e-05
medulloblastoma, large-cell 2.100 1.7e-05
primitive neuroectodermal tumor 2.200 5.3e-06
juvenile dermatomyositis 1.022 5.1e-11
acute quadriplegic myopathy 1.008 7.0e-06
lung cancer 1.100 3.7e-03
pediatric high grade glioma 1.600 6.1e-06
pilocytic astrocytoma 1.300 1.3e-06
primary Sjogren syndrome 1.500 2.5e-03
gastric carcinoma 1.100 2.4e-02
ovarian cancer 1.100 4.3e-02
Breast cancer 1.600 3.7e-06
dermatomyositis 1.900 1.4e-04

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (20)

PMID Text
24293108 Lamin B receptor mRNA expression was directly associated with tumor grade in breast cancer patients(grade 1 vs. grade 3 - 0.00 vs. 0.00; p = 0.0479) and Nottingham Prognostic Index (NPI1 vs. NPI3 - 0.00 vs. 0.00; p = 0.0551).
23824842 Mutation in LBR gene is associated with pelger-huet anomaly and a mild skeletal phenotype.
22581323 Lymphohematopoietic licence: sterol C-14 reductase activity of lamin B receptor (Lbr) is essential for neutrophil differentiation.
21795390 Our studies reveal for the first time a mechanism that controls the timing of nuclear envelope reassembly through modification of the integral nuclear membrane protein lamin B receptor
21327094 The LBR knockdown cells retain an ovoid shaped nucleus with reduced levels of lamin A/C during in vitro granulopoiesis induced with retinoic acid.
21327084 LBR missense mutations can abolish sterol reductase activity, causing lethal Greenberg dysplasia but not Pelger anomaly
21326950 a highly significant gene-dosage effect between the gene copy number and the nuclear segmentation index of neutrophils
21103616 LBR is heavily expressed in papillary thyroid carcinoma cells, but an abnormal folding of the protein might explain its lack of immunohistochemical reactivity and be associated with the anomalous folding of the nuclear membrane.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20576617 LBR targets the membrane precursor vesicles to chromatin by interacting with importin beta in a LBR phosphorylation-dependent manner during the NE assembly at the end of mitosis
19940018 LBR mutant variants and sterol reductases can severely interfere with the regular organization of the nuclear envelope and the endoplasmic reticulum.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19645629 results suggest that LMNA, ZMPSTE24, and LBR sequence variations are not major genetic determinants involved in scleroderma pathogenesis
19454010 Interaction of HIV-1 Tat with lamin B receptor in T-cells is identified by a proteomic strategy based on affinity chromatography
19331822 MeCP2 interacts in vitro and in vivo with the inner nuclear membrane protein LBR, and the unstructured aminoacidic sequence linking the MBD and TRD domains of MeCP2 is responsible for this association.
14718546 SR protein kinase and cdc2 kinase regulate lamin B receptor binding to chromatin
14701833 examination of temporal association with protamine 1 during spermiogenesis
12618959 Autosomal recessive HEM/Greenberg skeletal dysplasia is caused by 3 beta-hydroxysterol delta 14-reductase deficiency due to mutations in this gene.
12118250 Mutations in the gene encoding the lamin B receptor produce an altered nuclear morphology in granulocytes (Pelger-Huet anomaly).
11846796 The binding of lamin B receptor to chromatin is regulated by phosphorylation in the arginine-serine repeat-containing REGION

AA Sequence

MPSRKFADGEVVRGRWPGSSLYYEVEILSHDSTSQLYTVKYKDGTELELKENDIKPLTSFRQRKGGSTSS      1 - 70
SPSRRRGSRSRSRSRSPGRPPKSARRSASASHQADIKEARREVEVKLTPLILKPFGNSISRYNGEPEHIE     71 - 140
RNDAPHKNTQEKFSLSQESSYIATQYSLRPRREEVKLKEIDSKEEKYVAKELAVRTFEVTPIRAKDLEFG    141 - 210
GVPGVFLIMFGLPVFLFLLLLMCKQKDPSLLNFPPPLPALYELWETRVFGVYLLWFLIQVLFYLLPIGKV    211 - 280
VEGTPLIDGRRLKYRLNGFYAFILTSAVIGTSLFQGVEFHYVYSHFLQFALAATVFCVVLSVYLYMRSLK    281 - 350
APRNDLSPASSGNAVYDFFIGRELNPRIGTFDLKYFCELRPGLIGWVVINLVMLLAEMKIQDRAVPSLAM    351 - 420
ILVNSFQLLYVVDALWNEEALLTTMDIIHDGFGFMLAFGDLVWVPFIYSFQAFYLVSHPNEVSWPMASLI    421 - 490
IVLKLCGYVIFRGANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDLIMALAWSL    491 - 560
PCGFNHILPYFYIIYFTMLLVHREARDEYHCKKKYGVAWEKYCQRVPYRIFPYIY                   561 - 615
//

Text Mined References (59)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24293108 2013 The clinicopathological significance of lamin A/C, lamin B1 and lamin B receptor mRNA expression in human breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23824842 2013 Pelger-huet anomaly and a mild skeletal phenotype secondary to mutations in LBR.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22581323 2012 Lymphohematopoietic licence: sterol C-14 reductase activity of lamin B receptor (Lbr) is essential for neutrophil differentiation.
21795390 2011 Temporal control of nuclear envelope assembly by phosphorylation of lamin B receptor.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21327094 An in vitro model for Pelger-Huët anomaly: stable knockdown of lamin B receptor in HL-60 cells.
21327084 Mutations causing Greenberg dysplasia but not Pelger anomaly uncouple enzymatic from structural functions of a nuclear membrane protein.
21326950 Dosage effect of zero to three functional LBR-genes in vivo and in vitro.
21269460 2011 Initial characterization of the human central proteome.
21103616 2010 Nuclear shape in papillary thyroid carcinoma: a role for lamin B receptor?
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20576617 2010 Requirement for lamin B receptor and its regulation by importin {beta} and phosphorylation in nuclear envelope assembly during mitotic exit.
20522425 2010 LBR mutation and nuclear envelope defects in a patient affected with Reynolds syndrome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19940018 2010 Induction of a massive endoplasmic reticulum and perinuclear space expansion by expression of lamin B receptor mutants and the related sterol reductases TM7SF2 and DHCR7.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19645629 2009 LMNA, ZMPSTE24, and LBR are not mutated in scleroderma.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19331822 2009 Interaction between the inner nuclear membrane lamin B receptor and the heterochromatic methyl binding protein, MeCP2.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15882967 2005 The mammalian heterochromatin protein 1 binds diverse nuclear proteins through a common motif that targets the chromoshadow domain.
15698635 2005 Increased susceptibility of glutathione peroxidase-1 transgenic mice to kainic acid-related seizure activity and hippocampal neuronal cell death.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14718546 2004 Regulation of binding of lamin B receptor to chromatin by SR protein kinase and cdc2 kinase in Xenopus egg extracts.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701833 2004 Temporal association of protamine 1 with the inner nuclear membrane protein lamin B receptor during spermiogenesis.
14617022 2003 Lamin B-receptor mutations in Pelger-Huët anomaly.
12618959 2003 Autosomal recessive HEM/Greenberg skeletal dysplasia is caused by 3 beta-hydroxysterol delta 14-reductase deficiency due to mutations in the lamin B receptor gene.
12490533 2003 Mutations at the mouse ichthyosis locus are within the lamin B receptor gene: a single gene model for human Pelger-Huët anomaly.
12490158 Investigation of nuclear architecture with a domain-presenting expression system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438562 2002 Mapping sites of O-GlcNAc modification using affinity tags for serine and threonine post-translational modifications.
12118250 2002 Mutations in the gene encoding the lamin B receptor produce an altered nuclear morphology in granulocytes (Pelger-Huët anomaly).
11034899 2000 HA95 is a protein of the chromatin and nuclear matrix regulating nuclear envelope dynamics.
10828963 2000 Inner nuclear membrane protein LBR preferentially interacts with DNA secondary structures and nucleosomal linker.
10744724 2000 A novel pro-Arg motif recognized by WW domains.
10390541 1999 SR protein-specific kinase 1 is highly expressed in testis and phosphorylates protamine 1.
10049757 1999 SRPK1 and LBR protein kinases show identical substrate specificities.
9878250 1998 The human lamin B receptor/sterol reductase multigene family.
9169472 1997 Domain-specific interactions of human HP1-type chromodomain proteins and inner nuclear membrane protein LBR.
9003786 1996 The lamin B receptor (LBR) provides essential chromatin docking sites at the nuclear envelope.
8838815 1996 Chromosomal assignment of human nuclear envelope protein genes LMNA, LMNB1, and LBR by fluorescence in situ hybridization.
8663349 1996 Interaction between an integral protein of the nuclear envelope inner membrane and human chromodomain proteins homologous to Drosophila HP1.
8157663 1994 Characterization of the human gene encoding LBR, an integral protein of the nuclear envelope inner membrane.
8157662 1994 Primary structure analysis and lamin B and DNA binding of human LBR, an integral protein of the nuclear envelope inner membrane.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7679672 1993 The amino-terminal domain of the lamin B receptor is a nuclear envelope targeting signal.
2847165 1988 A lamin B receptor in the nuclear envelope.