Property Summary

NCBI Gene PubMed Count 25
PubMed Score 2.60
PubTator Score 29.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
group 3 medulloblastoma 1.900 1.7e-02
cystic fibrosis -4.034 2.9e-08
primitive neuroectodermal tumor 1.700 3.5e-02
Duchenne muscular dystrophy 1.024 7.9e-08
juvenile dermatomyositis 1.038 2.5e-09
primary pancreatic ductal adenocarcinoma 2.363 7.3e-04
intraductal papillary-mucinous carcinoma... -2.100 9.2e-04
lung cancer -2.500 3.8e-06
lung carcinoma -1.500 1.7e-13
Breast cancer -1.600 8.6e-09
gastric carcinoma 1.500 7.3e-03
ulcerative colitis 1.900 2.8e-04
ovarian cancer 2.400 5.5e-05
pancreatic cancer 2.200 1.5e-04
dermatomyositis 1.100 1.5e-02

Gene RIF (8)

PMID Text
25707478 LBH is a candidate gene for synovial pathology in rheumatoid arthritis. It is regulated by growth factors and modulates cell growth in primary fibroblast-like synoviocytes.
25557837 LBH normally induces NPC cell cycle arrest at the G1/S transition, and LBH can suppress the growth of transplanted NPC tumors in vivo by downregulating LMP1-mediated NF-kappaB transcriptional activity.
20606007 LBH is aberrantly overexpressed in mammary tumors of mouse mammary tumor virus (MMTV)-Wnt1-transgenic mice and in aggressive basal subtype human breast cancers that display Wnt/beta-catenin hyperactivation.
20587334 results showed that the interaction of LBH and alphaB-crystallin may inhibit synergistically the transcriptional regulation of p53 and p21
20546612 Observational study of gene-disease association. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
17390236 These results suggest that hLBH proteins may act as a transcriptional activator in mitogen-activated protein kinase signaling pathway to mediate cellular functions.
15958514 LBH is implicated as a candidate gene for congenital heart disease associated with partial trisomy 2p syndrome

AA Sequence

MSIYFPIHCPDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTE      1 - 70
GEVESGELRWPPEEFLVQEDEQDNCEETAKENKEQ                                        71 - 105
//

Text Mined References (29)

PMID Year Title
25707478 2015 The Rheumatoid Arthritis Risk Gene LBH Regulates Growth in Fibroblast-like Synoviocytes.
25557837 2015 Limb-bud and Heart (LBH) functions as a tumor suppressor of nasopharyngeal carcinoma by inducing G1/S cell cycle arrest.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21810271 2011 Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
20606007 2010 The embryonic transcription cofactor LBH is a direct target of the Wnt signaling pathway in epithelial development and in aggressive basal subtype breast cancers.
20587334 2010 Synergistic efficacy of LBH and alphaB-crystallin through inhibiting transcriptional activities of p53 and p21.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17390236 2008 A human homolog of mouse Lbh gene, hLBH, expresses in heart and activates SRE and AP-1 mediated MAPK signaling pathway.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16381901 2006 The LIFEdb database in 2006.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15958514 2005 Congenital heart disease reminiscent of partial trisomy 2p syndrome in mice transgenic for the transcription factor Lbh.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11336496 2001 Identification and characterization of Lbh, a novel conserved nuclear protein expressed during early limb and heart development.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11181995 2001 The sequence of the human genome.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.