Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.64
PubTator Score 8.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.200 3.4e-02
Astrocytoma, Pilocytic 1.500 2.3e-06
Breast cancer -2.000 4.2e-19
glioblastoma 1.300 3.5e-03
intraductal papillary-mucinous adenoma (... -2.300 2.1e-04
intraductal papillary-mucinous carcinoma... -2.500 3.5e-04
lung adenocarcinoma -1.200 1.1e-05
osteosarcoma 1.372 3.7e-02
ovarian cancer -1.600 5.0e-04
pituitary cancer -1.600 3.3e-07
spina bifida -2.241 4.8e-02
tuberculosis -1.700 4.1e-05

Gene RIF (3)

AA Sequence

MRPGTALQAVLLAVLLVGLRAATGRLLSASDLDLRGGQPVCRGGTQRPCYKVIYFHDTSRRLNFEEAKEA      1 - 70
CRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTACQDLYAWTDGSISQFRNWYV     71 - 140
DEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKNNFICKYSDEKPAVPSREAEGEETELTTPVL    141 - 210
PEETQEEDAKKTFKESREAALNLAYILIPSIPLLLLLVVTTVVCWVWICRKRKREQPDPSTKKQHTIWPS    211 - 280
PHQGNSPDLEVYNVIRKQSEADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFVTLVSVE    281 - 350
SGFVTNDIYEFSPDQMGRSKESGWVENEIYGY                                          351 - 382
//

Text Mined References (14)

PMID Year Title