Property Summary

NCBI Gene PubMed Count 71
PubMed Score 311.22
PubTator Score 73.18

Knowledge Summary

Patent (3,138)

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.600 1.4e-03
glioblastoma multiforme 1.500 9.6e-16
atypical teratoid / rhabdoid tumor 2.700 8.9e-07
primitive neuroectodermal tumor 1.600 1.0e-05
juvenile dermatomyositis 1.409 2.8e-13
acute quadriplegic myopathy 1.521 9.3e-06
adrenocortical carcinoma -1.036 1.1e-02
primary pancreatic ductal adenocarcinoma 2.458 1.3e-04
non-small cell lung cancer -1.448 2.1e-19
active ulcerative colitis 1.626 2.3e-02
breast carcinoma -1.200 2.0e-04
lung adenocarcinoma -1.100 1.9e-09
lung carcinoma -1.200 1.5e-24
spina bifida -2.045 2.3e-02
Pick disease 2.300 1.5e-04
gastric carcinoma 1.500 4.4e-03
ductal carcinoma in situ -1.100 3.3e-03
invasive ductal carcinoma -1.700 2.6e-04
acute myeloid leukemia 1.100 6.6e-03
ovarian cancer -3.400 1.3e-11
pituitary cancer -2.000 7.2e-05
pancreatic cancer 2.400 2.1e-04

Protein-protein Interaction (4)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (57)

PMID Text
25973055 our current data indicated a new regulatory mechanism of YAP1 by the LATS2-mediated phosphorylation that was involved in hepatocellular carcinoma tumorigenesis.
25946971 Loss of LATS2 expression is associated with lung cancer.
25841306 Both LATS1 and LATS2 were not related with the clinical variables in mucinous and clear cell carcinoma
25824045 miR-25/miR-107-LATS2 axis might play an important role in proliferation and invasion of the gastric cancer cells
25798586 Mutation in LATS2 gene is associated with malignant peritoneal mesothelioma.
25786116 Phosphorylation of CHO1 at S716 by Lats2 regulate its centrosomal localization, and that phosphorylated CHO1 interacts with and activates LIMK1 during early mitosis.
25782587 LATS2 could be induced by TNF-alpha and inhibited cell proliferation and invasion by phosphorylating YAP in OSCC cells.
25658096 Phosphorylation of S716 NDR/LATS, present only in the longest Kif23 isoform, is required for phosphorylation at S814, revealing phosphorylation at these two sites, and differential regulation of Kif23-14-3-3 interaction for the two Kif23 isoforms.
25482410 results reported here further support that LATS1/2 act normally as tumor suppressors and loss of their functions contributes to human cancer development
25391426 LATS2 was found to negatively regulate NF-kappaB signaling in NSCLC cells.
25179841 miR-25 negatively regulated LATS2 expression and promoted OC cell growth and motility.
25044019 LATS1 and LATS2 kinases play an important role in the regulation of NS5A function through site-specific post-translational modification and that phosphorylation of Ser/Thr71 is essential for optimal viral genome replication.
25026211 NF2 loss-driven derepressed CRL4(DCAF1) promotes activation of YAP by inhibiting hippo pathwat kinases Lats1 and 2 in the nucleus.
24976335 LATS2 expression level is predictive of survival in patients with resected lung AD. LATS2 may modulate and contribute to tumor growth via different signaling pathways in EGFR mutant and wild-type tumors.
24976283 LATS2 protein overexpression is a prognostic indicator for patients diagnosed with colorectal cancer.
24779718 MIR31 significantly suppressed the luciferase activity of mRNA combined with the LATS2 3'-UTR and consequently promoted the translocation of YAP1, a key molecule in the Hippo pathway, into the nucleus
24743869 LATS2 over-expression is associated with acute myeloid leukemia.
24735543 these results indicate that miR-181b promotes proliferation and invasion by targeting LATS2 in ovarian cancer cells.
24360964 LATS2 directly interacts with beta-catenin and disrupts beta-catenin iteraction with BCL9.
24225952 These results collectively suggest that the Hippo pathway negatively regulates the actin-binding activity of Amot family members through direct phosphorylation.
24106267 Thus AMOT is a direct substrate of Lats1/2 mediating functions of the Hippo pathway in endothelial cell migration and angiogenesis.
24101513 Data indicate that the phosphorylation of Amot130 by LATS1/2 is found to be a key feature that enables it to inhibit Yes-associated protein (YAP) dependent signaling and cell growth.
24026096 LATS1 and LATS2 mutations from cancers can lead to loss or reduction of their growth-inhibitory activity
23886938 Phosphorylation by Lats2 induces degradation of p21 and promotes apoptosis. Findings describe a novel Lats2-dependent mechanism for induction of cell death in response to severe DNA damage.
23852372 At low cell density, overexpression of the Hippo pathway kinase large tumor suppressor 2 (Lats2) inhibited c-Abl activity.
23267128 Identifying novel kinases which modulate Estrogen Receptor alpha activity is relevant to therapeutics. LATS2 modulates Estrogen Receptor alpha-regulated gene transcription, through direct and/or indirect interactions with Estrogen Receptor alpha.
23111389 LATS2 played important roles in mediating miR-93 functions associated with angiogenesis and metastasis by silencing.
22286172 LATS2 represses reprogramming in cells by post-transcriptionally antagonizing TAZ but not YAP, two downstream effectors of the Hippo pathway.
22098159 Yap induction mediated by inactivation of Lats is observed in hepatic malignancies.
22020941 MicroRNA-31 regulated by the extracellular regulated kinase is involved in vascular smooth muscle cell growth via large tumor suppressor homolog
21952048 Lats2 kinase as a novel regulator of Snail1 protein level, subcellular localization, and thus, activity
21832154 AMOTL2 is as a novel activator of LATS2.
21822051 the results suggest that the Aurora A-Lats1/2-Aurora B axis might be a novel pathway that regulates accurate mitotic progression by ensuring the proper mitotic localization of Lats2.
21498571 Results reveal a functional connection between the pRB and Hippo tumor suppressor pathways, and suggest that low levels of LATS2 may undermine the ability of pRB to induce a permanent cell cycle arrest in tumor cells.
21278236 Data suggest that defective expression of LATS2 is attributable to FOXP3 defects and may be a major independent determinant of YAP protein elevation in cancer.
21245096 Inactivation of LATS2 is one of the key mechanisms for constitutive activation of YAP, which induces deregulation of MM cell proliferation.
21233212 KIBRA associates with and activates Lats (large tumor suppressor) 1 and 2 kinases by stimulating their phosphorylation on the hydrophobic motif
21118956 In response to ultraviolet radiation, Lats2 is phosphorylated by Chk1 and Chk2 at S408.
21041410 Data show that Lats2 and ASPP1 shunt p53 to proapoptotic promoters and promote the death of polyploid cells.
20932276 LATS2 is de-methylated and overexpressed in nasopharyngeal carcinoma and predicts poor prognosis
20508983 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20335167 LATS2 tumor suppressor gene is regulated by tristetraprolin
19937137 down-regulation of expression in gastric cancer cell is associated with oncogenesis
19855428 Lats2 might have an important role in quenching H-Ras-induced transformation.
19799973 collection of genes identified suggests that LATS1/2 function through diverse mechanisms and multiple signaling pathways including the Hippo signaling pathway, as well as the p53, Ras-ERK, or WNT networks, to inhibit tumor progression
19501585 Data show that LATS2 protein expression is mediated by miR-373 at the post-transcriptional level and inversely correlates with miR-373 amounts in esophageal cancer cell lines.
19008013 tumor-specific mutations and down-regulation of the gene expression is observed in non-small cell lung carcinoma patients
18927464 Lats2 affects both growth and death of cardiac myocytes, but it primarily regulates the size of the heart and acts as an endogenous negative regulator of cardiac hypertrophy.
18565851 Kpm/Lats2 is involved in the fate of p73 through the phosphorylation of YAP2 by Kpm/Lats2 and the induction of p73 target genes that underlie chemosensitivity of leukemic cells.
17049657 LATS1 and LATS2 mRNA was down-regulated in astrocytoma by hypermethylation of the promoter
15746036 Hypermethylation of the promoter region of LATS2 likely plays an important role in the down-regulation of LATS2 mRNA level in breast cancers, and breast cancers with a decreased expression of LATS2 mRNA level have a biologically aggressive phenotype.
15688006 Mst2, a STE20-family member and purported Hpo ortholog, phosphorylates and activates both Lats1 and Lats2
15265683 Lats2 induces apoptosis through downregulating anti-apoptotic proteins, BCL-2 and BCL-x(L), in human lung cancer cells.
15147269 S83 of Lats2 is a phosphorylation target of Aurora-A and this phosphorylation plays a role of the centrosomal localization of Lats2
15131260 LATS2 may play a role in androgen receptor-mediated transcription and contribute to the development of prostate cancer
12853976 of mammalian Lats2 and Lats1 control cell proliferation by negatively regulating different cell cycle check points.

AA Sequence

MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQQQQMRATPKF      1 - 70
GPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMG     71 - 140
YLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRP    141 - 210
YVDYLFPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTP    211 - 280
PETGGYASLPTKGQGGPPGAGLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTP    281 - 350
SRNSLNVDLYELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG    351 - 420
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPAAEGLDAKEEH    421 - 490
ALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKS    491 - 560
AKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVNRRLQLEQE    561 - 630
MAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLR    631 - 700
KKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARF    701 - 770
YIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD    771 - 840
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQ    841 - 910
PPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLGRNGADDLKAHPFFSAIDFSS    911 - 980
DIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTKAWDTLTSPNNKHPEHAFYEFTFRRFFDDNG    981 - 1050
YPFRCPKPSGAEASQAESSDLESSDLVDQTEGCQPVYV                                   1051 - 1088
//

Text Mined References (76)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25973055 2015 LATS2-mediated YAP1 phosphorylation is involved in HCC tumorigenesis.
25946971 2015 LATS2 inhibits the activity of NF-? B signaling by disrupting the interaction between TAK1 and IKK?.
25841306 2015 Expression of LATS family proteins in ovarian tumors and its significance.
25824045 2015 miR-107 and miR-25 simultaneously target LATS2 and regulate proliferation and invasion of gastric adenocarcinoma (GAC) cells.
25798586 2015 Personalized oncogenomics: clinical experience with malignant peritoneal mesothelioma using whole genome sequencing.
25786116 2015 Phosphorylation of CHO1 by Lats1/2 regulates the centrosomal activation of LIMK1 during cytokinesis.
25782587 2015 LATS2 induced by TNF-alpha and inhibited cell proliferation and invasion by phosphorylating YAP in oral squamous cell carcinoma.
25658096 2015 Binding of Kif23-iso1/CHO1 to 14-3-3 is regulated by sequential phosphorylations at two LATS kinase consensus sites.
25482410 2015 Mutation analysis of large tumor suppressor genes LATS1 and LATS2 supports a tumor suppressor role in human cancer.
25391426 2015 Down-regulation of LATS2 in non-small cell lung cancer promoted the growth and motility of cancer cells.
25179841 2014 MiR-25 promotes ovarian cancer proliferation and motility by targeting LATS2.
25044019 2014 A novel immuno-competitive capture mass spectrometry strategy for protein-protein interaction profiling reveals that LATS kinases regulate HCV replication through NS5A phosphorylation.
25026211 2014 Merlin/NF2 loss-driven tumorigenesis linked to CRL4(DCAF1)-mediated inhibition of the hippo pathway kinases Lats1 and 2 in the nucleus.
24976335 2014 Aberrant large tumor suppressor 2 (LATS2) gene expression correlates with EGFR mutation and survival in lung adenocarcinomas.
24976283 Expression of hippo pathway in colorectal cancer.
24779718 2014 microRNA 31 functions as an endometrial cancer oncogene by suppressing Hippo tumor suppressor pathway.
24743869 2014 The expression analysis of LATS2 gene in de novo AML patients.
24735543 2014 MicroRNA-181b promotes ovarian cancer cell growth and invasion by targeting LATS2.
24682284 2014 Evolutionary and molecular facts link the WWC protein family to Hippo signaling.
24360964 2013 LATS2 suppresses oncogenic Wnt signaling by disrupting ?-catenin/BCL9 interaction.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24225952 2013 Actin-binding and cell proliferation activities of angiomotin family members are regulated by Hippo pathway-mediated phosphorylation.
24106267 2013 Phosphorylation of angiomotin by Lats1/2 kinases inhibits F-actin binding, cell migration, and angiogenesis.
24101513 2013 Serum deprivation inhibits the transcriptional co-activator YAP and cell growth via phosphorylation of the 130-kDa isoform of Angiomotin by the LATS1/2 protein kinases.
24026096 2013 Evidence for a tumor suppressor role for the large tumor suppressor genes LATS1 and LATS2 in human cancer.
23886938 2013 Lats2 phosphorylates p21/CDKN1A after UV irradiation and regulates apoptosis.
23852372 2013 The Hippo pathway kinase Lats2 prevents DNA damage-induced apoptosis through inhibition of the tyrosine kinase c-Abl.
23267128 2013 LATS2 is a modulator of estrogen receptor alpha.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23111389 2012 MiR-93 enhances angiogenesis and metastasis by targeting LATS2.
22286172 2012 Transcriptional analysis of pluripotency reveals the Hippo pathway as a barrier to reprogramming.
22098159 2012 Deregulation of Hippo kinase signalling in human hepatic malignancies.
22020941 2011 MicroRNA-31 regulated by the extracellular regulated kinase is involved in vascular smooth muscle cell growth via large tumor suppressor homolog 2.
21952048 2012 Lats2 kinase potentiates Snail1 activity by promoting nuclear retention upon phosphorylation.
21832154 2011 Angiomotin family proteins are novel activators of the LATS2 kinase tumor suppressor.
21822051 2011 The tumor suppressor Lats2 is pivotal in Aurora A and Aurora B signaling during mitosis.
21498571 2011 A kinase shRNA screen links LATS2 and the pRB tumor suppressor.
21278236 2011 Identification of a tumor suppressor relay between the FOXP3 and the Hippo pathways in breast and prostate cancers.
21245096 2011 LATS2 is a tumor suppressor gene of malignant mesothelioma.
21233212 2011 KIBRA regulates Hippo signaling activity via interactions with large tumor suppressor kinases.
21118956 2011 A novel Chk1/2-Lats2-14-3-3 signaling pathway regulates P-body formation in response to UV damage.
21041410 2010 The Lats2 tumor suppressor augments p53-mediated apoptosis by promoting the nuclear proapoptotic function of ASPP1.
20932276 2010 LATS2 is de-methylated and overexpressed in nasopharyngeal carcinoma and predicts poor prognosis.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20335167 2010 Stability of the LATS2 tumor suppressor gene is regulated by tristetraprolin.
20303269 2010 Ajuba LIM proteins are negative regulators of the Hippo signaling pathway.
19937137 2009 miR-372 regulates cell cycle and apoptosis of ags human gastric cancer cell line through direct regulation of LATS2.
19855428 2009 Silencing of the Lats2 tumor suppressor overrides a p53-dependent oncogenic stress checkpoint and enables mutant H-Ras-driven cell transformation.
19799973 2010 Identification of LATS transcriptional targets in HeLa cells using whole human genome oligonucleotide microarray.
19739119 2010 Molecular characterization of human homologs of yeast MOB1.
19501585 2009 MicroRNA-373 (miR-373) post-transcriptionally regulates large tumor suppressor, homolog 2 (LATS2) and stimulates proliferation in human esophageal cancer.
19008013 2009 LATS2 tumour specific mutations and down-regulation of the gene in non-small cell carcinoma.
18927464 2008 Lats2 is a negative regulator of myocyte size in the heart.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18565851 2008 Kpm/Lats2 is linked to chemosensitivity of leukemic cells through the stabilization of p73.
18158288 2008 Tumor suppressor LATS1 is a negative regulator of oncogene YAP.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17049657 2006 Promoter hypermethylation-mediated down-regulation of LATS1 and LATS2 in human astrocytoma.
17015431 2006 A positive feedback loop between the p53 and Lats2 tumor suppressors prevents tetraploidization.
16564011 2006 A genetic screen implicates miRNA-372 and miRNA-373 as oncogenes in testicular germ cell tumors.
16413547 2006 LATS2-Ajuba complex regulates gamma-tubulin recruitment to centrosomes and spindle organization during mitosis.
15746036 2005 Down-regulation of LATS1 and LATS2 mRNA expression by promoter hypermethylation and its association with biologically aggressive phenotype in human breast cancers.
15688006 2005 The Ste20-like kinase Mst2 activates the human large tumor suppressor kinase Lats1.
15265683 2004 Putative tumor suppressor Lats2 induces apoptosis through downregulation of Bcl-2 and Bcl-x(L).
15147269 2004 The centrosomal protein Lats2 is a phosphorylation target of Aurora-A kinase.
15131260 2004 The LATS2/KPM tumor suppressor is a negative regulator of the androgen receptor.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853976 2003 Lats2, a putative tumor suppressor, inhibits G1/S transition.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10871863 2000 Molecular cloning of a novel human protein kinase, kpm, that is homologous to warts/lats, a Drosophila tumor suppressor.
10673337 2000 Structure, expression, and chromosome mapping of LATS2, a mammalian homologue of the Drosophila tumor suppressor gene lats/warts.