Property Summary

NCBI Gene PubMed Count 69
PubMed Score 158.31
PubTator Score 67.48

Knowledge Summary

Patent (7,672)

TINX Plot

  Disease (4)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 6.1e-05
osteosarcoma 7933 3.6e-04
ovarian cancer 8491 5.0e-04
group 4 medulloblastoma 1875 7.9e-04
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 3.965 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.312 3.6e-04
group 4 medulloblastoma 1.700 7.9e-04
tuberculosis and treatment for 6 months 1.300 6.1e-05
ovarian cancer -1.100 5.0e-04

Protein-protein Interaction (5)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (49)

PMID Text
26116754 PARD3 promotes interaction between PP1A and LATS1 to induce LATS1 dephosphorylation and inactivation,leading to dephosphorylation and activation of TAZ
25841306 Both LATS1 and LATS2 were not related with the clinical variables in mucinous and clear cell carcinoma
25786116 Phosphorylation of CHO1 at S716 by Lats1 regulate its centrosomal localization, and that phosphorylated CHO1 interacts with and activates LIMK1 during early mitosis.
25772246 Loss of LATS1 expression is associated with breast neoplasms.
25743838 LATS1 promoter hypermethylation is associated with oral squamous cell carcinomas.
25723520 LATS1 phosphorylates the Thr7 residue of the APC/C component CDC26 directly
25658096 Phosphorylation of S716 NDR/LATS, present only in the longest Kif23 isoform, is required for phosphorylation at S814, revealing phosphorylation at these two sites, and differential regulation of Kif23-14-3-3 interaction for the two Kif23 isoforms.
25625370 These results demonstrated that as an inhibitor of YAP, LATS1 was decreased via downregulation of YAP using RNAi. This therefore indicated that the change in YAP levels in hepatocellular carcinoma cells may regulate LATS1 in a feedback manner.
25618271 ITCH up-regulation and LATS1 down-regulation were closely associated with tumorigenesis and progression of SCC
25482410 results reported here further support that LATS1/2 act normally as tumor suppressors and loss of their functions contributes to human cancer development
25393475 The control of LATS activation by angiotensin II and subsequent YAP localization is important for podocyte homeostasis and survival.
25362852 Findings suggest that polyomavirus middle T-antigen (PyMT) activates the Hippo pathway tumor suppressor Lats in a Src-dependent manner.
25270913 both LATS1 demethylation and overexpression of LATS1 downregulated the expression of Yes-associated protein (YAP), inhibited cell proliferation, induced cell apoptosis and cell cycle G1 arrest in 786-O cells
25218637 Data indicate that tumour suppressor RASSF1A triggers large tumor suppressor kinase 1 (LATS)-CDK2 interaction and restricts CDK2 kinase activity towards BRCA2.
25127217 Cyclic stretch is associated with a JNK-dependent increase in binding of a LATS inhibitor, LIMD1, to the LATS1 kinase and that reduction of LIMD1 expression suppresses the activation of YAP by cyclic stretch.
25044019 LATS1 and LATS2 kinases play an important role in the regulation of NS5A function through site-specific post-translational modification and that phosphorylation of Ser/Thr71 is essential for optimal viral genome replication.
25041856 ivation of MSH4 in germ cells may have played a role in the acquisition of additional TP53 and LATS1 germline mutations in a Li-Fraumeni family
25026211 NF2 loss-driven derepressed CRL4(DCAF1) promotes activation of YAP by inhibiting hippo pathwat kinases Lats1 and 2 in the nucleus.
25023289 overexpression of Kibra rescues the increased cell migration and aberrant three-dimensional morphogenesis induced by knockdown of PTPN14, and this rescue is mediated through the activation of the upstream LATS1 kinase
24682895 These results indicate that LATS1 may play an important role in NSCLC, and may serve as a novel therapeutic target of non-small-cell lung cancer (NSCLC).
24225952 These results collectively suggest that the Hippo pathway negatively regulates the actin-binding activity of Amot family members through direct phosphorylation.
24106267 Thus AMOT is a direct substrate of Lats1/2 mediating functions of the Hippo pathway in endothelial cell migration and angiogenesis.
24101513 Data indicate that the phosphorylation of Amot130 by LATS1/2 is found to be a key feature that enables it to inhibit Yes-associated protein (YAP) dependent signaling and cell growth.
24026096 LATS1 and LATS2 mutations from cancers can lead to loss or reduction of their growth-inhibitory activity
23885148 Decreased expression of LATS1 in CRC is associated with promoter hypermethylation, but not microsatellite instability status
23573293 LATS1 is critical in mediating WWP1-induced increased cell proliferation in breast cancer cells.
23230145 In conclusion, N-terminally truncated Lats1 induced Lats2 downregulation and Yap protein accumulation, leading to chromosomal instability and tumorigenesis.
22909338 These results indicate that LATS1 is an important candidate tumor suppressor and its downregulated expression may contribute to glioma progression
22641346 LATS1 phosphorylates a phosphatase as does the yeast Dbf2 and demonstrate a novel role of LATS1 in controlling PLK1 at the G2 DNA damage checkpoint.
21383157 study identifies E3 ubiquitin ligase Itch as a unique negative regulator of LATS1 and presents a possibility of targeting LATS1/Itch interaction as a therapeutic strategy in cancer.
21233212 KIBRA associates with and activates Lats (large tumor suppressor) 1 and 2 kinases by stimulating their phosphorylation on the hydrophobic motif
21212414 ubiquitin E3 ligase ITCH physically and functionally associates with LATS1
20508983 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20048001 YAP is phosphorylated by Lats on all of the five consensus HXRXXS motifs
19799973 collection of genes identified suggests that LATS1/2 function through diverse mechanisms and multiple signaling pathways including the Hippo signaling pathway, as well as the p53, Ras-ERK, or WNT networks, to inhibit tumor progression
18640976 Overexpression of YAP2 in cells promoted apoptosis, whereas the Mst2/Lats1-induced phosphorylation of YAP partially rescued the cells from apoptotic death.
18413746 Expression profiling of genes induced by ectopic expression of YAP or by knockdown of LATS1 reveals a subset of the potential Drosophila Hippo pathway targets implicated in epithelial-to-mesenchymal transition.
18158288 LATS1 inactivates YAP oncogenic function by suppressing its transcription regulation of cellular genes via sequestration of YAP in the cytoplasm after phosphorylation of YAP.
17049657 LATS1 and LATS2 mRNA was down-regulated in astrocytoma by hypermethylation of the promoter
16061636 Moderate overexpression of human LATS1 in cells exposed to microtubule poisons facilitated mitotic exit, and this activity required MOB1A.
16007220 Activation of Omi / HtrA2-mediated cell death is a potential mechanism for the tumor suppressive activity of WARTS.
15746036 Hypermethylation of the promoter region of LATS1 likely plays an important role in the down-regulation of LATS1 mRNA level in breast cancers, and breast cancers with a decreased expression of LATS1 mRNA level have a biologically aggressive phenotype.
15688006 Mst2, a STE20-family member and purported Hpo ortholog, phosphorylates and activates both Lats1 and Lats2
15220930 LATS1 is a novel cytoskeleton regulator that affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1.
15122335 WARTS plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G(1) tetraploidy checkpoint
12624101 kpm negatively regulates cell growth by inducing G(2)/M arrest and apoptotic cell death through its kinase activity
12379777 molecular alterations found in soft tissue sarcoma
12372621 regulation of function on the mitosis apparatus by Cdc/cyclin B

AA Sequence

MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPK      1 - 70
FGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEDMVIQALQKTNNRSIEAAIEFISK     71 - 140
MSYQDPRREQMAAAAARPINASMKPGNVQQSVNRKQSWKGSKESLVPQRHGPPLGESVAYHSESPNSQTD    141 - 210
VGRPLSGSGISAFVQAHPSNGQRVNPPPPPQVRSVTPPPPPRGQTPPPRGTTPPPPSWEPNSQTKRYSGN    211 - 280
MEYVISRISPVPPGAWQEGYPPPPLNTSPMNPPNQGQRGISSVPVGRQPIIMQSSSKFNFPSGRPGMQNG    281 - 350
TGQTDFMIHQNVVPAGTVNRQPPPPYPLTAANGQSPSALQTGGSAAPSSYTNGSIPQSMMVPNRNSHNME    351 - 420
LYNISVPGLQTNWPQSSSAPAQSSPSSGHEIPTWQPNIPVRSNSFNNPLGNRASHSANSQPSATTVTAIT    421 - 490
PAPIQQPVKSMRVLKPELQTALAPTHPSWIPQPIQTVQPSPFPEGTASNVTVMPPVAEAPNYQGPPPPYP    491 - 560
KHLLHQNPSVPPYESISKPSKEDQPSLPKEDESEKSYENVDSGDKEKKQITTSPITVRKNKKDEERRESR    561 - 630
IQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKM    631 - 700
DKSMFVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYY    701 - 770
SFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDG    771 - 840
HIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSL    841 - 910
VGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPE    911 - 980
ASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSD    981 - 1050
DNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYPYNYPKPIEYEYINSQGSEQQSDEDDQNTGS   1051 - 1120
EIKNRDLVYV                                                               1121 - 1130
//

Text Mined References (78)

PMID Year Title
26116754 2015 PARD3 induces TAZ activation and cell growth by promoting LATS1 and PP1 interaction.
25841306 2015 Expression of LATS family proteins in ovarian tumors and its significance.
25786116 2015 Phosphorylation of CHO1 by Lats1/2 regulates the centrosomal activation of LIMK1 during cytokinesis.
25772246 2015 Cell growth density modulates cancer cell vascular invasion via Hippo pathway activity and CXCR2 signaling.
25743838 2015 Hypermethylation of promoter region of LATS1--a CDK interacting protein in oral squamous cell carcinomas--a pilot study in India.
25723520 2015 LATS1 and LATS2 phosphorylate CDC26 to modulate assembly of the tetratricopeptide repeat subcomplex of APC/C.
25658096 2015 Binding of Kif23-iso1/CHO1 to 14-3-3 is regulated by sequential phosphorylations at two LATS kinase consensus sites.
25625370 2015 Knockdown of yes-associated protein inhibits proliferation and downregulates large tumor suppressor 1 expression in MHCC97H human hepatocellular carcinoma cells.
25618271 2014 Up-regulation of ITCH is associated with down-regulation of LATS1 during tumorigenesis and progression of cervical squamous cell carcinoma.
25482410 2015 Mutation analysis of large tumor suppressor genes LATS1 and LATS2 supports a tumor suppressor role in human cancer.
25393475 2014 The Hippo pathway is controlled by Angiotensin II signaling and its reactivation induces apoptosis in podocytes.
25362852 2015 The polyomavirus middle T-antigen oncogene activates the Hippo pathway tumor suppressor Lats in a Src-dependent manner.
25283809 2014 Ligand binding to WW tandem domains of YAP2 transcriptional regulator is under negative cooperativity.
25270913 2014 Methylation?associated inactivation of LATS1 and its effect on demethylation or overexpression on YAP and cell biological function in human renal cell carcinoma.
25218637 2014 RASSF1A-LATS1 signalling stabilizes replication forks by restricting CDK2-mediated phosphorylation of BRCA2.
25127217 2014 Regulation of YAP by mechanical strain through Jnk and Hippo signaling.
25044019 2014 A novel immuno-competitive capture mass spectrometry strategy for protein-protein interaction profiling reveals that LATS kinases regulate HCV replication through NS5A phosphorylation.
25041856 2014 TP53, MSH4, and LATS1 germline mutations in a family with clustering of nervous system tumors.
25026211 2014 Merlin/NF2 loss-driven tumorigenesis linked to CRL4(DCAF1)-mediated inhibition of the hippo pathway kinases Lats1 and 2 in the nucleus.
25023289 2014 PTPN14 forms a complex with Kibra and LATS1 proteins and negatively regulates the YAP oncogenic function.
24682895 2014 Expression of LATS1 contributes to good prognosis and can negatively regulate YAP oncoprotein in non-small-cell lung cancer.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24225952 2013 Actin-binding and cell proliferation activities of angiomotin family members are regulated by Hippo pathway-mediated phosphorylation.
24106267 2013 Phosphorylation of angiomotin by Lats1/2 kinases inhibits F-actin binding, cell migration, and angiogenesis.
24101513 2013 Serum deprivation inhibits the transcriptional co-activator YAP and cell growth via phosphorylation of the 130-kDa isoform of Angiomotin by the LATS1/2 protein kinases.
24026096 2013 Evidence for a tumor suppressor role for the large tumor suppressor genes LATS1 and LATS2 in human cancer.
24012335 2013 Spatial organization of Hippo signaling at the plasma membrane mediated by the tumor suppressor Merlin/NF2.
23885148 2013 Underexpression of LATS1 TSG in colorectal cancer is associated with promoter hypermethylation.
23573293 2013 WWP1 E3 ligase targets LATS1 for ubiquitin-mediated degradation in breast cancer cells.
23230145 2013 N-terminal truncation of Lats1 causes abnormal cell growth control and chromosomal instability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22909338 2012 Decreased expression of LATS1 is correlated with the progression and prognosis of glioma.
22863277 2012 Regulation of the Hippo-YAP pathway by G-protein-coupled receptor signaling.
22641346 2012 LATS1/WARTS phosphorylates MYPT1 to counteract PLK1 and regulate mammalian mitotic progression.
22078877 2011 The Hippo transducer TAZ confers cancer stem cell-related traits on breast cancer cells.
21383157 2011 Itch E3 ubiquitin ligase regulates large tumor suppressor 1 stability [corrected].
21233212 2011 KIBRA regulates Hippo signaling activity via interactions with large tumor suppressor kinases.
21212414 2011 Negative regulation of the Hippo pathway by E3 ubiquitin ligase ITCH is sufficient to promote tumorigenicity.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20303269 2010 Ajuba LIM proteins are negative regulators of the Hippo signaling pathway.
20048001 2010 A coordinated phosphorylation by Lats and CK1 regulates YAP stability through SCF(beta-TRCP).
19927127 2010 Regulation of ploidy and senescence by the AMPK-related kinase NUAK1.
19799973 2010 Identification of LATS transcriptional targets in HeLa cells using whole human genome oligonucleotide microarray.
19739119 2010 Molecular characterization of human homologs of yeast MOB1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18640976 2008 Mst2 and Lats kinases regulate apoptotic function of Yes kinase-associated protein (YAP).
18413746 2008 Negative regulation of YAP by LATS1 underscores evolutionary conservation of the Drosophila Hippo pathway.
18158288 2008 Tumor suppressor LATS1 is a negative regulator of oncogene YAP.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17049657 2006 Promoter hypermethylation-mediated down-regulation of LATS1 and LATS2 in human astrocytoma.
16061636 2005 Human LATS1 is a mitotic exit network kinase.
16007220 2005 The tumor suppressor WARTS activates the Omi / HtrA2-dependent pathway of cell death.
15746036 2005 Down-regulation of LATS1 and LATS2 mRNA expression by promoter hypermethylation and its association with biologically aggressive phenotype in human breast cancers.
15688006 2005 The Ste20-like kinase Mst2 activates the human large tumor suppressor kinase Lats1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15220930 2004 LATS1 tumour suppressor affects cytokinesis by inhibiting LIMK1.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15122335 2004 Tumor suppressor WARTS ensures genomic integrity by regulating both mitotic progression and G1 tetraploidy checkpoint function.
12624101 2003 Inhibition of cell growth by conditional expression of kpm, a human homologue of Drosophila warts/lats tumor suppressor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379777 2002 Molecular alterations of h-warts/LATS1 tumor suppressor in human soft tissue sarcoma.
12372621 2002 WARTS tumor suppressor is phosphorylated by Cdc2/cyclin B at spindle poles during mitosis.
10831611 2000 Zyxin, a regulator of actin filament assembly, targets the mitotic apparatus by interacting with h-warts/LATS1 tumor suppressor.
10518011 1999 A human homolog of Drosophila warts tumor suppressor, h-warts, localized to mitotic apparatus and specifically phosphorylated during mitosis.
9988269 1999 Mice deficient of Lats1 develop soft-tissue sarcomas, ovarian tumours and pituitary dysfunction.
9988268 1999 Human homologue of the Drosophila melanogaster lats tumour suppressor modulates CDC2 activity.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.
7743921 1995 Identifying tumor suppressors in genetic mosaics: the Drosophila lats gene encodes a putative protein kinase.