1. Home
  2. Targets
  3. LIM and SH3 domain protein 1

Tbio LIM and SH3 domain protein 1

Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types (By similarity).

This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012]

 Comments

Property Summary

NCBI Gene PubMed Count 65
PubMed Score 68.02
PubTator Score 64.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Autistic Disorder 320
Disease Target Count Z-score Confidence
Cancer 2346 3.449 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma 1.200 2.1e-02
astrocytoma 1.100 2.8e-02
Duchenne muscular dystrophy 1.293 4.2e-09
autosomal dominant Emery-Dreifuss muscul... 1.155 3.9e-03
juvenile dermatomyositis 1.290 1.0e-10
dermatomyositis 1.200 8.1e-03

Synonym

Accession Q14847 B4DGQ0 Q96ED2 Q96IG0 LASP-1
Symbols MLN50
Lasp-1

Gene

LASP1

PDB

3I35  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (18)

See all...

 GO Function (4)

 GO Component (5)

 GO Process (1)

 Compartment GO Term (41)

See all...

 MGI Phenotype (12)

See all...

 GWAS Trait (1)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

Gene RIF (46)

PMID Text
26797416 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26683818 LASP-1, mediated by miR-203, has crucial functions in the proliferation, migration and invasion of human non-small cell lung cancer
26414725 It is a target gene of miR-1.
26232936 Detecting an affection of migratory processes after LASP-1 silencing, we propose that LASP-1 could impact on metastasis of CC [choriocarcinoma]cells.
26061439 Results identified LASP1 as a hitherto unknown protein in melanocytes and as novel partner of dynamin in the physiological process of membrane constriction and melanosome vesicle release.
25982273 LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays
25760690 Our results suggest that LASP-1 mRNA overexpression may be mainly implicated in female hepatocellular carcinoma (HCC) and cirrhotic HCCs; and that LASP1 may play its role with vimentin in HCC cells.
25622104 LASP1 plays key roles in cell structure, physiological processes, and cell signaling; overexpression contributes to cancer aggressiveness [review]
25385028 Results defined LASP1 as a direct target gene for HIF1alpha upregulation that is critical for metastatic progression of PDAC.
25252758 LIM and SH3 protein 1 induces TGFbeta-mediated epithelial-mesenchymal transition in human colorectal cancer by regulating S100A4 expression.
24990592 LASP-1, overexpressed in gastric cancer and associated with poor prognosis, plays an important role in the growth and metastasis of gastric cancer.
24955835 LASP-1 overexpression was associated with aggressive phenotype in clear cell renal cell cancer.
24913448 Study revealed that LASP1 phosphorylation results in an association with CRKL - another specific BCR-ABL substrate and bona fide biomarker for BCR-ABL activity.
24815849 LASP1 was a direct target of miR-218 in prostate cells.
24554194 Results show significant upregulation of LASP1 and SCAD protein levels in acute psychotic bipolar disorder samples.
24386158 LASP-1 is linked closely to tumourigenicity in oral cancer.
23968734 Data show that miR-133a can target the 3' untranslated region (3'UTR) of LIM and SH3 protein 1 (LASP1) mRNA and suppress the expression of LASP1.
23254782 LASP1 may play an important role in the pathogenesis of esophageal squamous cell carcinoma.
23084841 High cytosolic LASP-1 expression is associated with hepatocellular carcinoma.
23040864 A single-nucleotide polymorphism in the LASP1 gene promoter region is associated with schizophrenia susceptibility.
22940702 miR-203 inhibits the migration and invasion of esophageal squamous cell carcinoma by regulating LASP1.
22897902 These results demonstrated that hepatitis B virus X protein could upregulate LASP-1 through PI3-K pathway to promote the proliferation and migration of hepatoma cells.
22713668 Up-regulated of BIRC5 and LASP1 was able to abrogate the effects induced by transfection with the miR-203 precursor in triple negative breast cancer.
22665060 Phosphorylation of LASP-1 by PKA at serine 146 induces translocation of the LASP-1/ZO-2 complex from the cytoplasm to the nucleus.
22514729 Data indicate that Lasp-1 is a novel component of podosomes and is involved in the regulation of podosomal function.
22481019 Data indicate decreased cell migratory potential accompanied by enhanced cell adhesion, but no significant inhibition of cell proliferation as measured by in T24 cells upon LIM and SH3 (LASP)-1 protein (LASP-1) knockdown.
21215099 LASP-1 gene expression enhances proliferation of colorectal cancer cells and may serve as a useful marker for colorectal cancer progression.
20924110 LASP1 knockdown by small interfering RNA-mediated silencing indicates its funcion role in progression and metastasis of medulloblastoma.
20843712 Data indicate that LASP1 may have an oncogenic function and that it might be regulated by miR-1, miR-133a, and miR-218, which may function as tumor suppressive miRNAs in bladder cancer (BC).
20812987 LASP-1, S100A9 and RhoGDI were detected by proteomic analysis to be differentially expressed between normal mucosa, non-metastatic colorectal carcinoma and metastatic CRC tissue
20660701 Overexpression of LASP-1 was found in metastatic colorectal cancer (CRC) tissues (p=0.002), and its expression level was closely correlated with overall survival of patients with CRC (p=0.002).
20461080 Nuclear LASP-1-positivity may serve as a negative prognostic indicator for long-term survival of breast cancer patients.
20419088 LASP-1 interaction with CXCR2 is critical for CXCR2-mediated chemotaxis
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19718473 LASP-1 translocation to the cytoskeleton of activated platelets correlates with LASP-1 phosphorylation at tyrosine 171 by Src-kinase
19177205 The ectopic expression of LASP-1 and uPA supported the proteomic results and showed that uPA up-regulation increased LASP-1 expression and that both were implicated in SKHep1C3 motility.
19155088 p53 may play a role in influencing tumor metastasis through Lasp1 in hepatocellular caarcinoma.
17956604 LASP-1 may have roles in progression of human breast carcinoma
17376794 Observational study of gene-disease association. (HuGE Navigator)
17211471 LASP-1 has an essential role in growth and migration of ovarian carcinoma cells, possibly by influencing the localization of zyxin.
16430883 LASP-1 has an essential role in tumor cell growth and migration, possibly by influencing the localization of zyxin.
15465019 Data suggest that there are no functional differences between human and mouse LASP-1.
15004028 LIM-nebulette, Lasp-1, and zyxin may play an important role in the organization of focal adhesions
12571245 phosphorylation of LASP by cGK and cAK may be involved in cytoskeletal organization and cell motility
12432067 In rabbits, lasp-1 localizes to sites of dynamic actin assembly, identifies sites that are phosphorylated by protein kinase A in vivo, and shows that the phosphorylation of these sites decreases F-actin-binding to lasp-1.
9688835 In rabbits, lasp-1 phosphorylation is increased by histamine H2 receptor activation and elevation of intracellular cAMP

AA Sequence 

MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE      1 - 70
NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME     71 - 140
PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV    141 - 210
YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI                       211 - 261
//

Text Mined References (78)

PMID Year Title
26797416 2016 LASP-1 induces proliferation, metastasis and cell cycle arrest at the G2/M phase in gallbladder cancer by down-regulating S100P via the PI3K/AKT pathway.
26683818 2016 LASP-1, regulated by miR-203, promotes tumor proliferation and aggressiveness in human non-small cell lung cancer.
26414725 2016 The tumor-suppressive function of miR-1 by targeting LASP1 and TAGLN2 in esophageal squamous cell carcinoma.
26232936 2016 The cytoskeletal protein LASP-1 differentially regulates migratory activities of choriocarcinoma cells.
26061439 2015 LASP1, a Newly Identified Melanocytic Protein with a Possible Role in Melanin Release, but Not in Melanoma Progression.
25982273 2016 LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25760690 2015 Molecular characterization of LASP-1 expression reveals vimentin as its new partner in human hepatocellular carcinoma cells.
25622104 2015 An update on the LIM and SH3 domain protein 1 (LASP1): a versatile structural, signaling, and biomarker protein.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25385028 2015 LASP1 is a HIF1? target gene critical for metastasis of pancreatic cancer.
25252758 2014 LIM and SH3 protein 1 induces TGF?-mediated epithelial-mesenchymal transition in human colorectal cancer by regulating S100A4 expression.
24990592 2014 LASP-1 promotes tumor proliferation and metastasis and is an independent unfavorable prognostic factor in gastric cancer.
24955835 2014 LIM and SH3 domain protein 1 (LASP-1) overexpression was associated with aggressive phenotype and poor prognosis in clear cell renal cell cancer.
24913448 2014 LASP1 is a novel BCR-ABL substrate and a phosphorylation-dependent binding partner of CRKL in chronic myeloid leukemia.
24815849 2014 Tumor-suppressive microRNA-218 inhibits cancer cell migration and invasion via targeting of LASP1 in prostate cancer.
24705354 2014 The palmitoyl acyltransferase HIP14 shares a high proportion of interactors with huntingtin: implications for a role in the pathogenesis of Huntington's disease.
24554194 2014 Search for peripheral biomarkers in patients affected by acutely psychotic bipolar disorder: a proteomic approach.
24386158 2013 Overexpression of LIM and SH3 Protein 1 leading to accelerated G2/M phase transition contributes to enhanced tumourigenesis in oral cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23968734 2013 miR-133a represses tumour growth and metastasis in colorectal cancer by targeting LIM and SH3 protein 1 and inhibiting the MAPK pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23254782 2013 Overexpression of LASP1 is associated with proliferation, migration and invasion in esophageal squamous cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084841 2013 LIM and SH3 protein 1, a promoter of cell proliferation and migration, is a novel independent prognostic indicator in hepatocellular carcinoma.
23040864 2013 Lasp1 is down-regulated in NMDA receptor antagonist-treated mice and implicated in human schizophrenia susceptibility.
22940702 2012 miR-203 inhibits the migration and invasion of esophageal squamous cell carcinoma by regulating LASP1.
22897902 2012 Role of hepatitis B virus X protein in regulating LIM and SH3 protein 1 (LASP-1) expression to mediate proliferation and migration of hepatoma cells.
22713668 2012 MicroRNA-203 suppresses cell proliferation and migration by targeting BIRC5 and LASP1 in human triple-negative breast cancer cells.
22665060 2013 Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions.
22514729 2012 Lasp-1 regulates podosome function.
22481019 2013 LASP-1, a novel urinary marker for detection of bladder cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21215099 2010 [Impact of LASP-1 expression on proliferation and tumorigenesis of human colorectal cancer cell line SW480].
20924110 2010 Role of LIM and SH3 protein 1 (LASP1) in the metastatic dissemination of medulloblastoma.
20843712 Functional role of LASP1 in cell viability and its regulation by microRNAs in bladder cancer.
20812987 2010 Comparative proteomic analysis identifies proteins associated with the development and progression of colorectal carcinoma.
20660701 2010 Promotion of colorectal cancer growth and metastasis by the LIM and SH3 domain protein 1.
20461080 2010 Nuclear localisation of LASP-1 correlates with poor long-term survival in female breast cancer.
20419088 2010 LIM and SH3 protein-1 modulates CXCR2-mediated cell migration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19726686 2009 Novel beta-propeller of the BTB-Kelch protein Krp1 provides a binding site for Lasp-1 that is necessary for pseudopodial extension.
19718473 2009 Integrin-dependent translocation of LASP-1 to the cytoskeleton of activated platelets correlates with LASP-1 phosphorylation at tyrosine 171 by Src-kinase.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19177205 2009 Proteomic identification of LASP-1 down-regulation after RNAi urokinase silencing in human hepatocellular carcinoma cells.
19155088 2009 LIM and SH3 protein 1 (Lasp1) is a novel p53 transcriptional target involved in hepatocellular carcinoma.
19060904 2009 An empirical framework for binary interactome mapping.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17956604 2007 Nuclear localization and cytosolic overexpression of LASP-1 correlates with tumor size and nodal-positivity of human breast carcinoma.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17376794 2007 High density SNP association study of a major autism linkage region on chromosome 17.
17211471 2007 Overexpression of LASP-1 mediates migration and proliferation of human ovarian cancer cells and influences zyxin localisation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16430883 2006 Silencing of LASP-1 influences zyxin localization, inhibits proliferation and reduces migration in breast cancer cells.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465019 2004 Phosphorylation of mouse LASP-1 on threonine 156 by cAMP- and cGMP-dependent protein kinase.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15004028 2004 Zyxin interacts with the SH3 domains of the cytoskeletal proteins LIM-nebulette and Lasp-1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12571245 2003 Actin binding of human LIM and SH3 protein is regulated by cGMP- and cAMP-dependent protein kinase phosphorylation on serine 146.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12432067 2002 Lasp-1 binds to non-muscle F-actin in vitro and is localized within multiple sites of dynamic actin assembly in vivo.
9848085 1998 Lasp-1, a novel type of actin-binding protein accumulating in cell membrane extensions.
9688835 1998 Lasp-1 is a regulated phosphoprotein within the cAMP signaling pathway in the gastric parietal cell.
7589475 1995 Lasp-1 (MLN 50) defines a new LIM protein subfamily characterized by the association of LIM and SH3 domains.
7490069 1995 Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17.