Tbio | LIM and SH3 domain protein 1 |
Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types (By similarity).
This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012]
This gene encodes a member of a subfamily of LIM proteins, characterized by a LIM motif and a domain of Src homology region 3, and also a member of the nebulin family of actin-binding proteins. The encoded protein is a cAMP and cGMP dependent signaling protein and binds to the actin cytoskeleton at extensions of the cell membrane. The encoded protein has been linked to metastatic breast cancer, hematopoetic tumors such as B-cell lymphomas, and colorectal cancer. [provided by RefSeq, Oct 2012]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Autistic Disorder | 364 | 0.0 | 0.0 |
Endometrial Neoplasms | 55 | 0.0 | 0.0 |
Disease | Target Count |
---|---|
Schizophrenia | 1160 |
Disease | Target Count | P-value |
---|---|---|
juvenile dermatomyositis | 1187 | 1.0e-10 |
Duchenne muscular dystrophy | 601 | 4.2e-09 |
autosomal dominant Emery-Dreifuss muscular dystrophy | 510 | 3.9e-03 |
dermatomyositis | 966 | 8.1e-03 |
esophageal adenocarcinoma | 737 | 2.1e-02 |
astrocytoma | 1146 | 2.8e-02 |
Disease | log2 FC | p |
---|---|---|
astrocytoma | 1.100 | 2.8e-02 |
autosomal dominant Emery-Dreifuss muscul... | 1.155 | 3.9e-03 |
dermatomyositis | 1.200 | 8.1e-03 |
Duchenne muscular dystrophy | 1.293 | 4.2e-09 |
esophageal adenocarcinoma | 1.200 | 2.1e-02 |
juvenile dermatomyositis | 1.290 | 1.0e-10 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA |
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPE 1 - 70 NLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGME 71 - 140 PERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAV 141 - 210 YDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI 211 - 261 //