Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.77
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
hepatocellular carcinoma 1.200 2.5e-04
pancreatic cancer 1.200 1.4e-03
osteosarcoma 2.155 2.5e-07
ependymoma 1.100 4.6e-04
glioblastoma 2.400 3.5e-06
atypical teratoid / rhabdoid tumor 2.000 5.4e-05
group 4 medulloblastoma 1.600 7.4e-04
medulloblastoma, large-cell 2.400 1.0e-04
primitive neuroectodermal tumor 1.200 4.2e-04
hereditary spastic paraplegia -1.222 3.5e-03
pancreatic ductal adenocarcinoma liver m... -1.168 5.6e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.9e-02
lung cancer 1.100 3.7e-02
active Crohn's disease 1.201 2.0e-02
pediatric high grade glioma 1.900 1.5e-05
pancreatic carcinoma 1.200 1.4e-03
breast carcinoma 1.100 1.7e-19
progressive supranuclear palsy -1.100 2.3e-02
ductal carcinoma in situ 1.200 5.6e-04
invasive ductal carcinoma 1.100 1.6e-03
ovarian cancer 1.200 9.8e-03

Gene RIF (5)

PMID Text
26644407 Involvement of LARP4 as a target of TNF-alpha-TTP regulation provides a clue as to how its functional activity may be used in a physiologic pathway.
23887937 The results demonstrate that the La modules of the human LARP4 is also active in tRNA-mediated suppression, even in the absence of stable UUU-3'OH trailer protection.
21098120 LARP4 activity is integrated with other PAM2 protein activities by PABP as part of mRNA homeostasis.
16682284 FISH study showed no cytogenetic abnormalities in any of the analyzed cases.
15572213 The c-MPL protein altered expression provide an opportunity to diagnose and identify subpopulations of MPD patients.

AA Sequence

MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEV      1 - 70
MYSSSCETTRNTTGIEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRENLSKDL     71 - 140
YLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT    141 - 210
PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAK    211 - 280
NGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNG    281 - 350
FNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGH    351 - 420
QEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGS    421 - 490
SSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQ    491 - 560
EKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEP    561 - 630
SSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQRRQFS    631 - 700
HRAIPQGVTRRNGKEQYVPPRSPK                                                  701 - 724
//

Text Mined References (31)

PMID Year Title
26644407 2015 LARP4 Is Regulated by Tumor Necrosis Factor Alpha in a Tristetraprolin-Dependent Manner.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23887937 2013 Conservation of RNA chaperone activity of the human La-related proteins 4, 6 and 7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21098120 2011 La-related protein 4 binds poly(A), interacts with the poly(A)-binding protein MLLE domain via a variant PAM2w motif, and can promote mRNA stability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16682284 2006 Detection of abnormalities of PRV-1, TPO, and c-MPL genes detected by fluorescence in situ hybridization in essential thrombocythemia.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15572213 2005 Molecular pathogenesis of Philadelphia chromosome negative myeloproliferative disorders.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.