| Tbio | La-related protein 4 |
Plays a role in the regulation of cell morphology and cytoskeletal organization.
Comments
| Disease | Target Count |
|---|---|
| Polycystic Ovary Syndrome | 334 |
| Disease | Target Count | P-value |
|---|---|---|
| breast carcinoma | 1614 | 1.7e-19 |
| osteosarcoma | 7933 | 2.5e-07 |
| glioblastoma | 5572 | 3.5e-06 |
| pediatric high grade glioma | 2712 | 1.5e-05 |
| atypical teratoid / rhabdoid tumor | 4369 | 5.4e-05 |
| medulloblastoma, large-cell | 6234 | 1.0e-04 |
| hepatocellular carcinoma | 550 | 2.5e-04 |
| primitive neuroectodermal tumor | 3031 | 4.2e-04 |
| ependymoma | 2514 | 4.6e-04 |
| ductal carcinoma in situ | 1745 | 5.6e-04 |
| group 4 medulloblastoma | 1875 | 7.4e-04 |
| pancreatic cancer | 2300 | 1.4e-03 |
| pancreatic carcinoma | 567 | 1.4e-03 |
| invasive ductal carcinoma | 2950 | 1.6e-03 |
| hereditary spastic paraplegia | 313 | 3.5e-03 |
| pancreatic ductal adenocarcinoma liver metastasis | 1795 | 5.6e-03 |
| ovarian cancer | 8491 | 9.8e-03 |
| active Crohn's disease | 918 | 2.0e-02 |
| progressive supranuclear palsy | 674 | 2.3e-02 |
| lung cancer | 4473 | 3.7e-02 |
| intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 4.9e-02 |
| Disease | log2 FC | p |
|---|---|---|
| hepatocellular carcinoma | 1.200 | 2.5e-04 |
| pancreatic cancer | 1.200 | 1.4e-03 |
| osteosarcoma | 2.155 | 2.5e-07 |
| ependymoma | 1.100 | 4.6e-04 |
| glioblastoma | 2.400 | 3.5e-06 |
| atypical teratoid / rhabdoid tumor | 2.000 | 5.4e-05 |
| group 4 medulloblastoma | 1.600 | 7.4e-04 |
| medulloblastoma, large-cell | 2.400 | 1.0e-04 |
| primitive neuroectodermal tumor | 1.200 | 4.2e-04 |
| hereditary spastic paraplegia | -1.222 | 3.5e-03 |
| pancreatic ductal adenocarcinoma liver m... | -1.168 | 5.6e-03 |
| intraductal papillary-mucinous neoplasm ... | 1.200 | 4.9e-02 |
| lung cancer | 1.100 | 3.7e-02 |
| active Crohn's disease | 1.201 | 2.0e-02 |
| pediatric high grade glioma | 1.900 | 1.5e-05 |
| pancreatic carcinoma | 1.200 | 1.4e-03 |
| breast carcinoma | 1.100 | 1.7e-19 |
| progressive supranuclear palsy | -1.100 | 2.3e-02 |
| ductal carcinoma in situ | 1.200 | 5.6e-04 |
| invasive ductal carcinoma | 1.100 | 1.6e-03 |
| ovarian cancer | 1.200 | 9.8e-03 |
| PMID | Text | |
|---|---|---|
| 26644407 | Involvement of LARP4 as a target of TNF-alpha-TTP regulation provides a clue as to how its functional activity may be used in a physiologic pathway. | |
| 23887937 | The results demonstrate that the La modules of the human LARP4 is also active in tRNA-mediated suppression, even in the absence of stable UUU-3'OH trailer protection. | |
| 21098120 | LARP4 activity is integrated with other PAM2 protein activities by PABP as part of mRNA homeostasis. | |
| 16682284 | FISH study showed no cytogenetic abnormalities in any of the analyzed cases. | |
| 15572213 | The c-MPL protein altered expression provide an opportunity to diagnose and identify subpopulations of MPD patients. |
MLLFVEQVASKGTGLNPNAKVWQEIAPGNTDATPVTHGTESSWHEIAATSGAHPEGNAELSEDICKEYEV 1 - 70 MYSSSCETTRNTTGIEESTDGMILGPEDLSYQIYDVSGESNSAVSTEDLKECLKKQLEFCFSRENLSKDL 71 - 140 YLISQMDSDQFIPIWTVANMEEIKKLTTDPDLILEVLRSSPMVQVDEKGEKVRPSHKRCIVILREIPETT 141 - 210 PIEEVKGLFKSENCPKVISCEFAHNSNWYITFQSDTDAQQAFKYLREEVKTFQGKPIMARIKAINTFFAK 211 - 280 NGYRLMDSSIYSHPIQTQAQYASPVFMQPVYNPHQQYSVYSIVPQSWSPNPTPYFETPLAPFPNGSFVNG 281 - 350 FNSPGSYKTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGH 351 - 420 QEQTYLQKETSTLQVEQNGDYGRGRRTLFRGRRRREDDRISRPHPSTAESKAPTPKFDLLASNFPPLPGS 421 - 490 SSRMPGELVLENRMSDVVKGVYKEKDNEELTISCPVPADEQTECTSAQQLNMSTSSPCAAELTALSTTQQ 491 - 560 EKDLIEDSSVQKDGLNQTTIPVSPPSTTKPSRASTASPCNNNINAATAVALQEPRKLSYAEVCQKPPKEP 561 - 630 SSVLVQPLRELRSNVVSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQRRQFS 631 - 700 HRAIPQGVTRRNGKEQYVPPRSPK 701 - 724 //
| PMID | Year | Title | |
|---|---|---|---|
| 26644407 | 2015 | LARP4 Is Regulated by Tumor Necrosis Factor Alpha in a Tristetraprolin-Dependent Manner. | |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 24129315 | 2014 | Immunoaffinity enrichment and mass spectrometry analysis of protein methylation. | |
| 23887937 | 2013 | Conservation of RNA chaperone activity of the human La-related proteins 4, 6 and 7. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. | |
| 22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. | |
| 21834987 | 2011 | Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration. | |
| 21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 21098120 | 2011 | La-related protein 4 binds poly(A), interacts with the poly(A)-binding protein MLLE domain via a variant PAM2w motif, and can promote mRNA stability. | |
| 20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. | |
| 19946888 | 2010 | Defining the membrane proteome of NK cells. | |
| 19690332 | 2009 | Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. | |
| 19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. | |
| 18691976 | 2008 | Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. | |
| 18669648 | 2008 | A quantitative atlas of mitotic phosphorylation. | |
| 17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. | |
| 17081983 | 2006 | Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. | |
| 16964243 | 2006 | A probability-based approach for high-throughput protein phosphorylation analysis and site localization. | |
| 16682284 | 2006 | Detection of abnormalities of PRV-1, TPO, and c-MPL genes detected by fluorescence in situ hybridization in essential thrombocythemia. | |
| 16541075 | 2006 | The finished DNA sequence of human chromosome 12. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15572213 | 2005 | Molecular pathogenesis of Philadelphia chromosome negative myeloproliferative disorders. | |
| 15498874 | 2004 | Large-scale cDNA transfection screening for genes related to cancer development and progression. | |
| 15144186 | 2004 | Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 9110174 | 1997 | Large-scale concatenation cDNA sequencing. | |
| 8619474 | 1996 | A "double adaptor" method for improved shotgun library construction. |
