Property Summary

NCBI Gene PubMed Count 16
PubMed Score 75.02
PubTator Score 21.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
non-small cell lung cancer 1.386 5.1e-19

Gene RIF (7)

PMID Text
26220087 Reduced levels of GYLTL1B and ISPD mRNA associated with increased patient mortality and are the likely cause of alphaDG hypoglycosylation in ccRCC.
25455932 LARGE2 is negatively regulated by Snail and/or ZEB1, revealing a mechanistic basis for alphaDG hypoglycosylation during prostate cancer progression and metastasis.
23223448 Loss of LARGE2 disrupts functional glycosylation of alpha-dystroglycan in prostate cancer
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)
15752776 LARGE2 was found to support the maturation of alpha-dystroglycan more effectively than LARGE.

AA Sequence

MLPRGRPRALGAAALLLLLLLLGFLLFGGDLGCERREPGGRAGAPGCFPGPLMPRVPPDGRLRRAAALDG      1 - 70
DPGAGPGDHNRSDCGPQPPPPPKCELLHVAIVCAGHNSSRDVITLVKSMLFYRKNPLHLHLVTDAVARNI     71 - 140
LETLFHTWMVPAVRVSFYHADQLKPQVSWIPNKHYSGLYGLMKLVLPSALPAELARVIVLDTDVTFASDI    141 - 210
SELWALFAHFSDTQAIGLVENQSDWYLGNLWKNHRPWPALGRGFNTGVILLRLDRLRQAGWEQMWRLTAR    211 - 280
RELLSLPATSLADQDIFNAVIKEHPGLVQRLPCVWNVQLSDHTLAERCYSEASDLKVIHWNSPKKLRVKN    281 - 350
KHVEFFRNFYLTFLEYDGNLLRRELFVCPSQPPPGAEQLQQALAQLDEEDPCFEFRQQQLTVHRVHVTFL    351 - 420
PHEPPPPRPHDVTLVAQLSMDRLQMLEALCRHWPGPMSLALYLTDAEAQQFLHFVEASPVLAARQDVAYH    421 - 490
VVYREGPLYPVNQLRNVALAQALTPYVFLSDIDFLPAYSLYDYLRASIEQLGLGSRRKAALVVPAFETLR    491 - 560
YRFSFPHSKVELLALLDAGTLYTFRYHEWPRGHAPTDYARWREAQAPYRVQWAANYEPYVVVPRDCPRYD    561 - 630
PRFVGFGWNKVAHIVELDAQEYELLVLPEAFTIHLPHAPSLDISRFRSSPTYRDCLQALKDEFHQDLSRH    631 - 700
HGAAALKYLPALQQPQSPARG                                                     701 - 721
//

Text Mined References (18)

PMID Year Title
26220087 2015 Downregulation of dystroglycan glycosyltransferases LARGE2 and ISPD associate with increased mortality in clear cell renal cell carcinoma.
25455932 2015 The glycosyltransferase LARGE2 is repressed by Snail and ZEB1 in prostate cancer.
25138275 2014 Endogenous glucuronyltransferase activity of LARGE or LARGE2 required for functional modification of ?-dystroglycan in cells and tissues.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23223448 2013 Loss of LARGE2 disrupts functional glycosylation of ?-dystroglycan in prostate cancer.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
19587235 2009 Tumor suppressor function of laminin-binding alpha-dystroglycan requires a distinct beta3-N-acetylglucosaminyltransferase.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16341674 2005 Transcriptome analysis of human gastric cancer.
15958417 2005 Characterization of the LARGE family of putative glycosyltransferases associated with dystroglycanopathies.
15752776 2005 LARGE2 facilitates the maturation of alpha-dystroglycan more effectively than LARGE.
15661757 2005 Localization and functional analysis of the LARGE family of glycosyltransferases: significance for muscular dystrophy.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.