Property Summary

NCBI Gene PubMed Count 76
PubMed Score 86.11
PubTator Score 84.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia -1.700 5.0e-02
Alzheimer's disease -1.200 1.9e-02
Astrocytoma, Pilocytic 1.500 9.2e-04
atypical teratoid / rhabdoid tumor 2.100 1.0e-03
Breast cancer 1.400 9.6e-06
breast carcinoma 1.200 3.2e-08
colon cancer 1.400 2.2e-03
Common variable immunodeficiency -1.000 5.0e-02
dermatomyositis -1.400 2.7e-03
ependymoma 1.800 4.6e-07
esophageal adenocarcinoma 1.700 1.8e-02
glioblastoma 1.600 3.0e-04
group 3 medulloblastoma 1.800 2.9e-02
hepatocellular carcinoma 1.100 3.0e-03
invasive ductal carcinoma -1.341 2.6e-02
lung adenocarcinoma 1.100 2.9e-04
lung cancer 2.600 4.9e-05
lung carcinoma 1.400 3.8e-12
malignant mesothelioma 1.300 3.0e-06
medulloblastoma, large-cell 2.700 1.2e-06
non-small cell lung cancer 2.107 3.7e-17
osteosarcoma 5.833 1.7e-07
ovarian cancer 2.900 9.9e-05
pancreatic cancer 1.500 9.0e-03
pancreatic carcinoma 1.500 9.0e-03
pancreatic ductal adenocarcinoma liver m... 1.725 3.3e-02
pediatric high grade glioma 1.600 1.7e-03
Pick disease -1.200 7.4e-04
primitive neuroectodermal tumor 1.400 8.0e-04
tuberculosis and treatment for 3 months -1.200 7.4e-03

 GWAS Trait (1)

Pathway (1)

Gene RIF (63)

AA Sequence

MELHERPDERRKARTSTQGRLGDWRRVHADGFTHRVLGAPAAAWSSSSWLEPAMTSRTRVTWPSPPRPLP      1 - 70
VPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARAT     71 - 140
APGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPDQYNFSSSELGGDFEF    141 - 210
MDDANMCIAIAISLLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQL    211 - 280
PPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPP    281 - 350
YDDATVNGAAKEPPPPYVSA                                                      351 - 370
//

Text Mined References (76)

PMID Year Title