Property Summary

NCBI Gene PubMed Count 66
PubMed Score 76.30
PubTator Score 84.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
hepatocellular carcinoma 1.100 3.0e-03
pancreatic cancer 1.500 9.0e-03
malignant mesothelioma 1.700 1.3e-07
esophageal adenocarcinoma 1.700 1.8e-02
osteosarcoma 5.833 1.7e-07
posterior fossa group B ependymoma 2.000 5.2e-08
glioblastoma 1.600 3.0e-04
sonic hedgehog group medulloblastoma 2.100 1.5e-03
atypical teratoid/rhabdoid tumor 2.300 1.9e-04
medulloblastoma, large-cell 2.700 1.2e-06
primitive neuroectodermal tumor 1.400 8.0e-04
tuberculosis and treatment for 3 months -1.200 7.4e-03
pancreatic ductal adenocarcinoma liver m... 1.725 3.3e-02
non-small cell lung cancer 2.107 3.7e-17
Common variable immunodeficiency -1.000 5.0e-02
lung cancer 2.800 1.4e-03
colon cancer 1.400 2.2e-03
pediatric high grade glioma 1.600 1.7e-03
pilocytic astrocytoma 1.500 9.1e-04
pancreatic carcinoma 1.500 9.0e-03
lung adenocarcinoma 2.139 6.6e-09
invasive ductal carcinoma 2.700 4.3e-03
lung carcinoma 1.400 3.8e-12
breast carcinoma 1.200 3.2e-08
Alzheimer's disease -1.200 1.9e-02
Pick disease -1.200 7.4e-04
acute myeloid leukemia -1.700 5.0e-02
ovarian cancer 2.900 9.9e-05
Breast cancer 1.400 9.6e-06
dermatomyositis -1.400 2.7e-03

Synonym

Accession Q86VI4 Q3ZCV5 Q7L909 Q86VH8 Q9H060
Symbols LC27
LAPTM4beta

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (56)

PMID Text
26383850 Findings provide evidence that LAPTM4B plays an important role in promoting tumor angiogenesis.
26343532 Our study points to the relevance of LAPTM4B expression to NSCLC pathogenesis as well as to the probable role of LAPTM4B/NRF2 signaling in promoting lung cancer cell survival.
26280656 By compartmentalizing ceramide, LAPTM4B controls key sphingolipid-mediated cell death mechanisms and emerges as a candidate for sphingolipid-targeting cancer therapies.
26126825 LAPTM4B binds to GARP and is a negative regulator of TGF-beta1 production in human Tregs
25998567 LAPTM4b recruits LAT1-4F2hc to lysosomes, leading to uptake of leucine into lysosomes.
25910706 LAPTM4B-35 overexpression is associated with small cell lung cancer.
25849595 These findings indicate that LAPTM4B-35 overexpression may be related to GC progression and poor prognosis, and thus may serve as a new prediction marker of prognosis in GC patients.
25714029 Authors found that restoration of miR-188-5p can inhibit the PI3K/AKT signaling pathway via the suppression of LAPTM4B.
25689860 LAPTM4B-35 over-expression was an independent factor in gastric carcinoma prognosis
25588945 The results reveal an essential layer of EGFR trafficking regulated by LAPTM4B, PtdIns(4,5)P2 signaling, and the ESCRT complex and define a mechanism by which the oncoprotein LAPTM4B can transform cells and promote tumor progression.
25416438 LAPTM4B-35 is consistently expressed in gastric cancer and is associated with specific clinicopathological and immunohistochemical characteristics.
25001088 no association between LAPTM4B polymorphism and the risk of breast cancer in a sample of Iranian population
24816841 Overexpression of LAPTM4B protein is correlated with tumor angiogenesis and poor prognosis in non-small cell lung cancer.
24746178 The LAPTM4B *2 allele was associated with increasing risk of multiple cancers, tumor initiation and development in Chinese populations. [meta-analysis]
24676601 The results suggest that LAPTM4B polymorphisms may be a prospective marker for evaluating the risk and prognosis of non-small cell lung cancer.
24651764 Overexpression of LAPTM4B-35 may be associated with tumor progression and poor prognosis in prostate cancer.
24563515 LAPTM4B, with increased expression in airways at shorter distance from tumors, was upregulated in human immortalized cells compared with normal bronchial epithelial cells and promoted anchorage-dependent and independent lung cancer cell growth.
23469012 study identified the core promoter region responsible for constitutive expression of LAPTM4B and clarified that CREB1 played an important role in LAPTM4B transcriptional regulation in human breast cancer cells
23364988 SNPs in lysosomal-associated transmembrane protein 4 beta (LAPTM4B) and insulin-like growth factor 1 (IGF1) were associated with both susceptibility to and curve severity in adolescent idiopathic scoliosis in Korea.
23345117 The results of our study indicated that the polymorphism of LAPTM4B gene did not influence the susceptibility of nasopharyngeal carcinoma in the Chinese population
23312008 Endometrial carcinoma patients with LAPTM4B *2 variant had both significantly shorter overall survival and disease-free survival.
23292099 High LAPTM4B expression is associated with lymph node metastasis, and recurrence in breast cancer.
23023342 LAPTM4B was found to not exhibit any expression changes between different classes of pituitary adenomas.
22984631 Data suggest that lysosomal protein transmembrane 4 beta (LAPTM4B) status may be useful in preoperative evaluation of the operability of gallbladder carcinoma (GBC).
22984585 LAPTM4B*2 is a risk factor associated with breast cancer susceptibility and poor prognosis
22971479 LAPTM4B-35 was found to be present at high levels in a large proportion of patients with pancreatic carcinoma, and was closely related to disease progression and poor prognosis.
22578410 LAPTM4B overexpression is an independent factor in poor colorectal cancer prognosis, and it may be an important potential biomarker.
22509374 LAPTM4B is a risk factor associated with poor prognosis in patients with resected HCC. LAPTM4B status may be useful preoperatively as an adjunct in evaluation of the operability of HCC.
22412199 Findings indicate that the LAPTM4B 2 allele may be a risk factor for ovarian cancer and may play an important role in genetic susceptibility to ovarian cancer.
22302286 LAPTM4B allele *2 may be a risk factor associated with genetic susceptibility to GBC.
22270081 LAPTM4B allelic variation was significantly associated with breast cancer occurrence, with adjusted odds ratios of 1.387 (95%CI = 1.111-1.730) for LAPTM4B*1/2 and 1.592 (95% CI = 1.043-2.430) for LAPTM4B*2/2 genotype.
22207410 allele *2 of LAPTM4B appears to be associated with genetic susceptibility of HCC and may therefore be considered as a risk factor.
22193644 LAPTM4B expression was found to have a significant inverse correlation on prognosis in patients with metastatic ovarian tumors and may be an independent prognostic marker for metastatic ovarian tumors.
22156622 gene polymorphism of LAPTM4B may influence the individuals' susceptibility to primary liver cancer.
22037872 Data show that LAPTM4B protein was localized in lysosomes where its depletion increased membrane permeability, pH, cathepsin release, and cellular apoptosis.
21656743 the LAPTM4B*2 allele might be a cervical cancer risk factor and may play an important role in genetic susceptibility to cervical cancer in the Chinese population.
21618708 Upregulation of LAPTM4B-35 promotes malignant transformation and liver tumorigenesis.
21429547 overexpression of LAPTM4B-35 attenuated epirubicin-induced apoptosis of gallbladder carcinoma GBC-SD cells through a mitochondria-dependent pathway
21416470 Over-expression of LAPTM4B is associated with chemotherapy resistance and stages III and IV epithelial ovarian cancer
20881850 LAPTM4B-35 may be associated with tumor progression in cervical carcinoma
20711237 LAPTM4B-35 motivates multidrug resistance of cancer cells by promoting drug efflux
20583413 LAPTM4B expressed in GBC-SD cells at a relatively low level. Forced overexpression of LAPTM4B increased invasive potential of GBC-SD cells, through modulating molecules associated with degradation of extracellular matrix.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20358632 LAPTM4B-35 is a novel prognostic factor of hepatocellular carcinoma.
19843073 LAPTM4B-35 and its PPRP motif play critical roles in proliferation and metastatic potential of hepatocellular carcinoma cells.
19690886 LAPTM4B-35 expression showed a strong association with recurrence, metastasis and progression of hepatoma.
18949404 LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma.
18334282 LAPTM4B-35 positively expressed in a great portion of extrahepatic cholangiocarcinoma and might be a novel molecular maker of progression, invasiveness and poor prognosis.
17965115 These results indicate that the genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer.
17965115 Observational study of gene-disease association. (HuGE Navigator)
17074969 Observational study of gene-disease association. (HuGE Navigator)
17074969 LAPTM4B gene polymorphism is associated with gastric cancer
16769693 We have demonstrated intergenic splicing between two sets of family genes, the matrilin-3 (MATN3) and lysosomal-associated protein transmembrane 4alpha (LAPTM4A).
15968325 Observational study of gene-disease association. (HuGE Navigator)
15911104 LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance
15162524 LAPTM4B gene encoded two isoforms of tetratransmembrane proteins, LAPTM4B-35 and LAPTM4B-24 and expression of LAPTM4B-35 protein is upregulated and associated with poor differentiation in human hepatocellular carcinoma tissues

AA Sequence

MELHERPDERRKARTSTQGRLGDWRRVHADGFTHRVLGAPAAAWSSSSWLEPAMTSRTRVTWPSPPRPLP      1 - 70
VPAAAAVAFGAKGTDPAEARSSRGIEEAGPRAHGRAGREPERRRSRQQRRGGLQARRSTLLKTCARARAT     71 - 140
APGAMKMVAPWTRFYSNSCCLCCHVRTGTILLGVWYLIINAVVLLILLSALADPDQYNFSSSELGGDFEF    141 - 210
MDDANMCIAIAISLLMILICAMATYGAYKQRAAWIIPFFCYQIFDFALNMLVAITVLIYPNSIQEYIRQL    211 - 280
PPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLISCVWNCYRYINGRNSSDVLVYVTSNDTTVLLPP    281 - 350
YDDATVNGAAKEPPPPYVSA                                                      351 - 370
//

Text Mined References (66)

PMID Year Title
26383850 2015 LAPTM4B down regulation inhibits the proliferation, invasion and angiogenesis of HeLa cells in vitro.
26343532 2015 LAPTM4B is associated with poor prognosis in NSCLC and promotes the NRF2-mediated stress response pathway in lung cancer cells.
26280656 2015 LAPTM4B facilitates late endosomal ceramide export to control cell death pathways.
26126825 2015 Lysosomal-associated Transmembrane Protein 4B (LAPTM4B) Decreases Transforming Growth Factor ?1 (TGF-?1) Production in Human Regulatory T Cells.
25998567 2015 LAPTM4b recruits the LAT1-4F2hc Leu transporter to lysosomes and promotes mTORC1 activation.
25910706 2015 Lysosome-associated protein transmembrane-4?-35 is a novel independent prognostic factor in small cell lung cancer.
25849595 2015 LAPTM4B-35, a cancer-related gene, is associated with poor prognosis in TNM stages I-III gastric cancer patients.
25714029 2015 miR-188-5p inhibits tumour growth and metastasis in prostate cancer by repressing LAPTM4B expression.
25689860 2015 Lysosomal-associated protein transmembrane 4 Beta-35 overexpression is a novel independent prognostic marker for gastric carcinoma.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
25588945 2015 LAPTM4B is a PtdIns(4,5)P2 effector that regulates EGFR signaling, lysosomal sorting, and degradation.
25416956 2014 A proteome-scale map of the human interactome network.
25416438 2014 LAPTM4B-35 protein as a potential therapeutic target in gastric cancer.
25001088 2014 Association between LAPTM4B gene polymorphism and breast cancer susceptibility in an Iranian population.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24816841 2014 Overexpression of LAPTM4B is correlated with tumor angiogenesis and poor prognosis in non-small cell lung cancer.
24746178 2014 LAPTM4B polymorphism increases susceptibility to multiple cancers in Chinese populations: a meta-analysis.
24676601 2014 LAPTM4B polymorphism is associated with non?small cell lung cancer susceptibility and prognosis.
24651764 2014 Overexpression of LAPTM4B-35: a novel marker of poor prognosis of prostate cancer.
24563515 2014 Transcriptomic architecture of the adjacent airway field cancerization in non-small cell lung cancer.
23469012 2013 cAMP responsive element binding protein-1 is a transcription factor of lysosomal-associated protein transmembrane-4 Beta in human breast cancer cells.
23364988 2013 Analysis of single nucleotide polymorphism in adolescent idiopathic scoliosis in Korea: for personalized treatment.
23345117 2013 Association of LAPTM4B gene polymorphism with nasopharyngeal carcinoma susceptibility in a Chinese population.
23312008 2013 LAPTM4B gene polymorphism and endometrial carcinoma risk and prognosis.
23292099 2013 Overexpression of LAPTM4B: an independent prognostic marker in breast cancer.
23023342 2012 Expression of genes FOLR1, BAG1 and LAPTM4B in functioning and non-functioning pituitary adenomas.
22984631 2012 LAPTM4B allele *2 is a marker of poor prognosis for gallbladder carcinoma.
22984585 2012 LAPTM4B allele *2 is associated with breast cancer susceptibility and prognosis.
22971479 2012 Elevated lysosome-associated protein transmembrane-4?-35 is an independent prognostic marker in pancreatic carcinoma.
22578410 2012 Overexpression of LAPTM4B-35 is associated with poor prognosis in colorectal carcinoma.
22509374 2012 LAPTM4B allele *2 is a marker of poor prognosis following hepatic tumor resection for hepatocellular carcinoma.
22412199 2012 LAPTM4B polymorphisms is associated with ovarian cancer susceptibility and its prognosis.
22302286 2012 Correlation of LAPTM4B polymorphisms with gallbladder carcinoma susceptibility in Chinese patients.
22270081 2012 Association of LAPTM4B gene polymorphism with breast cancer susceptibility.
22207410 2012 Correlation of LAPTM4B polymorphisms with hepatocellular carcinoma in Chinese patients.
22193644 2012 LAPTM4B overexpression is a novel independent prognostic marker for metastatic ovarian tumors.
22156622 2012 Relationship between LAPTM4B gene polymorphism and susceptibility of primary liver cancer.
22037872 2011 Lysosomal transmembrane protein LAPTM4B promotes autophagy and tolerance to metabolic stress in cancer cells.
21656743 2011 Correlation of LAPTM4B polymorphisms with cervical carcinoma.
21618708 2011 Upregulation of LAPTM4B-35 promotes malignant transformation and tumorigenesis in L02 human liver cell line.
21429547 2011 Overexpression of LAPTM4B-35 attenuates epirubucin-induced apoptosis of gallbladder carcinoma GBC-SD cells.
21416470 2011 Over-expression of LAPTM4B is associated with poor prognosis and chemotherapy resistance in stages III and IV epithelial ovarian cancer.
20881850 2010 Overexpression of LAPTM4B-35 in cervical carcinoma: a clinicopathologic study.
20711237 2010 LAPTM4B: a novel cancer-associated gene motivates multidrug resistance through efflux and activating PI3K/AKT signaling.
20583413 Expression of LAPTM4B in gallbladder carcinoma cells: the role in invasive potential.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20358632 2010 LAPTM4B-35 is a novel prognostic factor of hepatocellular carcinoma.
19843073 2009 LAPTM4B-35, a novel tetratransmembrane protein and its PPRP motif play critical roles in proliferation and metastatic potential of hepatocellular carcinoma cells.
19690886 2010 LAPTM4B-35 overexpression is a risk factor for tumor recurrence and poor prognosis in hepatocellular carcinoma.
18949404 2008 LAPTM4B overexpression is an independent prognostic marker in ovarian carcinoma.
18334282 2008 Expression of LAPTM4B-35: a novel marker of progression, invasiveness and poor prognosis of extrahepatic cholangiocarcinoma.
17965115 2008 Relationship between LAPTM4B gene polymorphism and susceptibility of colorectal and esophageal cancers.
17074969 2007 Relationship between LAPTM4B gene polymorphism and susceptibility of gastric cancer.
16769693 2005 MATN and LAPTM are parts of larger transcription units produced by intergenic splicing: intergenic splicing may be a common phenomenon.
16381901 2006 The LIFEdb database in 2006.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15968325 2005 [Relationship between LAPTM4B gene polymorphism and susceptibility of lung cancer].
15911104 2005 The human LAPTM4b transcript is upregulated in various types of solid tumours and seems to play a dual functional role during tumour progression.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15162524 2004 Structure analysis and expressions of a novel tetratransmembrane protein, lysosoma-associated protein transmembrane 4 beta associated with hepatocellular carcinoma.
12902989 2003 Molecular cloning and characterization of LAPTM4B, a novel gene upregulated in hepatocellular carcinoma.
12640618 2003 Fire exit is a potential four transmembrane protein expressed in developing Drosophila glia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.