Property Summary

NCBI Gene PubMed Count 12
PubMed Score 173.81
PubTator Score 76.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.200 1.3e-03
Multiple myeloma 1.732 3.0e-04
osteosarcoma 1.411 2.0e-04
ovarian cancer -1.600 8.4e-06

 GO Process (1)

Gene RIF (1)

AA Sequence

MVSMSFKRNRSDRFYSTRCCGCCHVRTGTIILGTWYMVVNLLMAILLTVEVTHPNSMPAVNIQYEVIGNY      1 - 70
YSSERMADNACVLFAVSVLMFIISSMLVYGAISYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEY     71 - 140
LDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCYKYINNRNVPEIAVYPAFEAPPQY    141 - 210
VLPTYEMAVKMPEKEPPPPYLPA                                                   211 - 233
//

Text Mined References (15)

PMID Year Title