Property Summary

NCBI Gene PubMed Count 26
PubMed Score 662.10
PubTator Score 122.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Multiple myeloma 2.274 4.9e-03
cutaneous lupus erythematosus 1.800 5.0e-04
glioblastoma 2.300 3.5e-04
juvenile dermatomyositis 1.877 4.0e-10
tuberculosis 1.400 1.2e-04
primary pancreatic ductal adenocarcinoma 1.020 9.0e-03
sarcoidosis 1.100 2.4e-02
interstitial cystitis 1.500 1.6e-03
cystic fibrosis 1.100 6.1e-03
sonic hedgehog group medulloblastoma 1.100 2.3e-03
primary Sjogren syndrome 1.800 3.4e-03
lung carcinoma -1.200 8.5e-19
progressive supranuclear palsy -1.200 7.7e-03
ovarian cancer 2.600 3.5e-04
dermatomyositis 2.100 1.8e-03

 GO Process (1)

Gene RIF (6)

PMID Text
25453285 LAP3 might be a new prognostic factor and be close correlation with glioma cell growth, migration, invasion.
25120751 our results indicated that up-regulated expression of LAP3 might contribute to the proliferation and metastasis of hepatocellular carcinoma
24477662 Overexpression of leucine aminopeptidase 3 contributes to malignant development of human esophageal squamous cell carcinoma.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16513116 results suggest that Lys528 is important for maximal activity of adipocyte-derived LAP by maintaining the appropriate structure of the substrate pocket of the enzyme

AA Sequence

MFLLPLPAAGRVVVRRLAVRRFGSRSLSTADMTKGLVLGIYSKEKEDDVPQFTSAGENFDKLLAGKLRET      1 - 70
LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKENIRAAVAAGCRQIQDLELSSV     71 - 140
EVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEM    141 - 210
TPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFV    211 - 280
GKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVV    281 - 350
RAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFE    351 - 420
ASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKD    421 - 490
EVPYLRKGMTGRPTRTLIEFLLRFSQDNA                                             491 - 519
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25453285 2015 LAP3 promotes glioma progression by regulating proliferation, migration and invasion of glioma cells.
25120751 2014 Expression of leucine aminopeptidase 3 (LAP3) correlates with prognosis and malignant development of human hepatocellular carcinoma (HCC).
24477662 2014 Overexpression of leucine aminopeptidase 3 contributes to malignant development of human esophageal squamous cell carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16513116 2006 Reduced activity of the hypertension-associated Lys528Arg mutant of human adipocyte-derived leucine aminopeptidase (A-LAP)/ER-aminopeptidase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8506345 1993 Differentiation and identification of the two catalytic metal binding sites in bovine lens leucine aminopeptidase by x-ray crystallography.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6350155 1983 Suggested assignment of peptidase S (PEPS) to 4p11-4q12 by exclusion using gene dosage, accounting for variability in fibroblasts.
4692835 1973 Leucine aminopeptidase (Bovine lens). Mechanism of activation by Mg 2+ and Mn 2+ of the zinc metalloenzyme, amino acid composition, and sulfhydryl content.
3733731 1986 Immunoaffinity purification and characterization of leucine aminopeptidase from human liver.
1908238 1991 Structural and immunological evidence for the identity of prolyl aminopeptidase with leucyl aminopeptidase.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
752543 1978 Comparative gene mapping: the linkage relationships of the homologous genes for phosphoglucomutase and peptidase S are conserved in man and mouse.
752511 1978 Regional assignment of genes for phosphoglucomutase2 and peptidase S to 4pter leads to 4q21 in man.
689684 1978 Assignment of peptidase S (PEPS) to chromosome 4 in man using somatic cell hybrids.