Property Summary

NCBI Gene PubMed Count 17
PubMed Score 14.61
PubTator Score 24.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.800 2.3e-07
glioblastoma -1.400 9.1e-05
medulloblastoma, large-cell -1.300 1.6e-04
lung cancer 1.200 9.3e-04
adult high grade glioma -1.200 1.2e-03
pilocytic astrocytoma -1.100 7.7e-06
posterior fossa group A ependymoma -1.100 2.1e-08
psoriasis 1.100 4.3e-17
pituitary cancer 1.200 5.7e-06

Gene RIF (7)

PMID Text
25273559 Data indicate that lanthionine synthetase C-like 2 (LanCL2) depletion sensitizes cells to apoptosis through down-regulating serine/threonine protein kinase Akt phosphorylation.
22037458 human recombinant LANCL2 binds abscisic acid (ABA) directly and provide the first demonstration of ABA binding to a mammalian ABA receptor.
20512604 Molecular docking studies predict that ABA and other PPAR gamma agonists (e.g., rosiglitazone and pioglitazone) share a binding site on the surface of LANCL2.
19667068 Data show that lanthionine synthetase C-like protein (LANCL2) is required for abscisic acid binding on human granulocyte membranes and that LANCL2 is necessary for transduction of the ABA signal into granulocytes and rat insulinoma cells.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
12566319 Lanthionine synthetase components C-like 2 increases cellular sensitivity to adriamycin by decreasing the expression of P-glycoprotein through a transcription-mediated mechanism.
11762191 cDNA cloned and characterized. May play a role as a component of a peptide-modifying complex

AA Sequence

MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKII      1 - 70
HNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNL     71 - 140
NGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYL    141 - 210
NTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKV    211 - 280
DQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMEC    281 - 350
SDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEG    351 - 420
MAGAIHFLSDVLGPETSRFPAFELDSSKRD                                            421 - 450
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25273559 2014 Lanthionine synthetase C-like protein 2 (LanCL2) is a novel regulator of Akt.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22037458 2011 Binding of abscisic acid to human LANCL2.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20512604 2011 Molecular modeling of lanthionine synthetase component C-like protein 2: a potential target for the discovery of novel type 2 diabetes prophylactics and therapeutics.
19667068 2009 LANCL2 is necessary for abscisic acid binding and signaling in human granulocytes and in rat insulinoma cells.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16979580 2006 Myristoylation of human LanC-like protein 2 (LANCL2) is essential for the interaction with the plasma membrane and the increase in cellular sensitivity to adriamycin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12566319 2003 Lanthionine synthetase components C-like 2 increases cellular sensitivity to adriamycin by decreasing the expression of P-glycoprotein through a transcription-mediated mechanism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11762191 2001 Molecular cloning, characterization, and tissue-specific expression of human LANCL2, a novel member of the LanC-like protein family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.