Property Summary

NCBI Gene PubMed Count 45
PubMed Score 139.77
PubTator Score 36.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.220 4.9e-03
Multiple myeloma 1.638 1.8e-04
pancreatic ductal adenocarcinoma liver m... -1.400 2.3e-02
ovarian cancer 1.700 3.2e-03

Synonym

Accession O43504 Q6IBD8
Symbols XIP
HBXIP

Gene

PDB

3MS6   3MSH  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

Gene RIF (37)

PMID Text
26828265 Thus, we conclude that the oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells. Therapeutically, HBXIP may serve as a novel target in breast cancer.
26719542 Results support a model in which the HBXIP/Hotair/LSD1 complex serves as a critical effector of c-Myc in activating transcription of its target genes, illuminating long-standing questions on how c-Myc drives carcinogenesis.
26309161 oncoprotein HBXIP enhances glucose metabolism reprogramming through suppressing SCO2 and PDHA1 in breast cancer
26229107 highly expressed HBXIP accelerates the MDM2-mediated degradation of p53 in breast cancer through modulating the feedback loop of MDM2/p53, resulting in the fast growth of breast cancer cells.
25686500 HBXIP promotes the migration of breast cancer cells through modulating microtubule acetylation mediated by GCN5.
25178941 Our study suggested that high HBXIP is associated with the progression of breast cancer. HBXIP could be a valuable prognostic marker as well as a potential molecular therapy target for breast cancer patients.
24886421 Hepatitis B protein HBx accelerates hepatocarcinogenesis with partner survivin through modulating tumor suppressor miR-520b and oncoprotein HBXIP.
24882622 HBXIP facilitates the proliferation of hepatoma cells by up-regulating SCG3 via E2F1 and miR-509-3p modulation.
24788380 Dta show that HBXIP was able to stimulate the activity of Skp2 promoter via transcription factor Sp1 thus promoting the migration of ovarian cancer cells.
24464787 The oncoprotein HBXIP enhances angiogenesis and growth of breast cancer through modulating FGF8 and VEGF.
23667255 HBXIP nuclear import requires interaction with c-Fos and phosphorylation of both proteins in breast cancer cells
23537647 HBXIP promotes the proliferation of breast cancer cells via upregulating PDGFB.
23494474 conclude that the oncoprotein HBXIP as a co-activator of TF II D transactivates Lin28B promoter via directly binding to TBP to upregulate the expression of Lin28B in promotion of proliferation of breast cancer cells
23352642 found that HBXIP was able to stimulate the promoter of Skp2 through binding to the -640/-443 region in Skp2 promoter involving activating E2F transcription factor 1
23291272 oncoprotein HBXIP is able to activate the transcriptional coregulatory protein LMO4 through transcription factor Sp1 in promotion of proliferation of breast cancer cells.
23266610 knockdown of HBXIP rescued the inhibition of HBV that occurred after the loss of miR-501 in HepG2.2.15 cells, suggesting that miR-501 induced HBV replication partially by targeting HBXIP.
22980980 Study identified HBXIP and C7orf59 as two additional Ragulator components that are required for mTORC1 activation by amino acids.
22740693 HBXIP up-regulates S100A4 through activating S100A4 promoter involving STAT4 and inducing PTEN/PI3K/AKT signaling to promote growth and migration of breast cancer cells.
22293503 Data suggest that HBXIP upregulates CD46, CD55 and CD59 through p-ERK1/2/NF-kappaB signaling to protect breast cancer from complement-dependent cytotoxicity.
22209835 overexpression of HBXIP increased HepG2 cell-induced endothelial cells migration, proliferation, and angiogenesis, which may be related to increasing phosphorylation of endothelial NO synthase in HUVECs.
21651858 The different structure forms of HBx protein influence their intracellular distribution in hepatocellular carcinoma HepG2 cells
21343296 miR-520b is involved in regulating breast cancer cell migration by targeting HBXIP and IL-8 via a network in which HBXIP promotes migration by stimulating NF-kappaB-mediated IL-8 expression.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20811532 The x gene of HBV (HBx) is the most common open reading frame integrated into the host genome in hepatocellular carcinoma and the integrated HBx is frequently mutated in hepatocellular carcinoma.
19885569 the overexpression of survivin in the majority of NSCLCs together with the abundant or upregulated expression of HBXIP and XIAP suggest that tumours are endowed with resistance against a variety of apoptosis-inducing conditions.
18976975 Knockdown of hepatitis B virus x interacting protein (HBXIP) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
18158869 HBXIP significantly stimulated the transcription and expression of telomerase reverse transcriptase and increased the activity of telomerase
18032378 HBXIP is a critical target of viral HBx for promoting genetic instability through formation of defective spindles and subsequent aberrant chromosome segregation.
17428866 Hepatitis B virus X protein stimulates the mitochondrial translocation of Raf-1 via oxidative stress
17303008 One of the functions of HBXIP is its involvement in cell proliferation
17050029 The codon-38 change in genotype C is an independent risk factor for the development of HCC and may serve as a useful molecular marker for predicting the clinical outcomes in patients infected with HBV.
16176273 suppressor of var1, 3-like 1 protein interacts with HBXIP, previously identified as a cofactor of survivin in suppression of apoptosis
16055925 HBXIP sensitizes HepG2 cells to UV light-induced DNA damage.
15955450 HBXIP up-regulates LTA expression in hepatocytes.
12773388 Survivin-HBXIP complexes, but neither survivin nor HBXIP individually, bind pro-caspase-9, preventing its recruitment to Apaf1, and thereby selectively suppressing apoptosis.
11925594 Elevated levels of GDN/PN1 and XIP mRNAs induced by Allitridi provide valuable molecular evidence for elucidating garlic's efficacies against neurodegenerative and inflammatory diseases.
11788598 Hepatitis B virus pX interacts with HBXAP

AA Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESD      1 - 70
NGNIMIQKHDGITVAVHKMAS                                                      71 - 91
//

Text Mined References (53)

PMID Year Title
26828265 2016 The oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells.
26719542 2016 HBXIP and LSD1 Scaffolded by lncRNA Hotair Mediate Transcriptional Activation by c-Myc.
26309161 2015 The oncoprotein HBXIP promotes glucose metabolism reprogramming via downregulating SCO2 and PDHA1 in breast cancer.
26229107 2015 The oncoprotein HBXIP modulates the feedback loop of MDM2/p53 to enhance the growth of breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686500 2015 The oncoprotein HBXIP promotes migration of breast cancer cells via GCN5-mediated microtubule acetylation.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25178941 2014 HBXIP expression predicts patient prognosis in breast cancer.
24886421 2014 Hepatitis B virus X protein accelerates hepatocarcinogenesis with partner survivin through modulating miR-520b and HBXIP.
24882622 2014 The oncoprotein HBXIP up-regulates SCG3 through modulating E2F1 and miR-509-3p in hepatoma cells.
24788380 2014 The oncoprotein hepatitis B X-interacting protein promotes the migration of ovarian cancer cells through the upregulation of S-phase kinase-associated protein 2 by Sp1.
24464787 2014 The oncoprotein HBXIP enhances angiogenesis and growth of breast cancer through modulating FGF8 and VEGF.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24169621 2014 Elucidating novel hepatitis C virus-host interactions using combined mass spectrometry and functional genomics approaches.
23667255 2013 The nuclear import of oncoprotein hepatitis B X-interacting protein depends on interacting with c-Fos and phosphorylation of both proteins in breast cancer cells.
23537647 2013 The oncoprotein HBXIP upregulates PDGFB via activating transcription factor Sp1 to promote the proliferation of breast cancer cells.
23494474 2013 The oncoprotein HBXIP upregulates Lin28B via activating TF II D to promote proliferation of breast cancer cells.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23352642 2013 The oncoprotein HBXIP up-regulates Skp2 via activating transcription factor E2F1 to promote proliferation of breast cancer cells.
23291272 2013 The oncoprotein HBXIP activates transcriptional coregulatory protein LMO4 via Sp1 to promote proliferation of breast cancer cells.
23266610 2013 MicroRNA-501 promotes HBV replication by targeting HBXIP.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
22740693 2012 The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells.
22293503 2012 HBXIP upregulates CD46, CD55 and CD59 through ERK1/2/NF-?B signaling to protect breast cancer cells from complement attack.
22209835 2012 Overexpression of hepatitis B x-interacting protein in HepG2 cells enhances tumor-induced angiogenesis.
21651858 2011 [The different structure forms of HBx protein influence their intracellular distribution in hepatocellular carcinoma HepG2 cells].
21343296 2011 miR-520b regulates migration of breast cancer cells by targeting hepatitis B X-interacting protein and interleukin-8.
21269460 2011 Initial characterization of the human central proteome.
21059355 2011 Structural characterization of HBXIP: the protein that interacts with the anti-apoptotic protein survivin and the oncogenic viral protein HBx.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20811532 2010 Hepatocellular carcinoma and the underlying mechanisms.
19885569 2009 Increased expression of inhibitor of apoptosis proteins, survivin and XIAP, in non-small cell lung carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18158869 2008 Promotion of cell proliferation by HBXIP via upregulation of human telomerase reverse transcriptase in human mesenchymal stem cells.
18032378 2008 Interaction of hepatitis B viral oncoprotein with cellular target HBXIP dysregulates centrosome dynamics and mitotic spindle formation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17428866 2007 Hepatitis B virus X protein stimulates the mitochondrial translocation of Raf-1 via oxidative stress.
17303008 2007 Involvement of hepatitis B X-interacting protein (HBXIP) in proliferation regulation of cells.
17050029 2006 Nucleotide change of codon 38 in the X gene of hepatitis B virus genotype C is associated with an increased risk of hepatocellular carcinoma.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16176273 2005 Human ATP-dependent RNA/DNA helicase hSuv3p interacts with the cofactor of survivin HBXIP.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16055925 2005 The hepatitis B virus X protein sensitizes HepG2 cells to UV light-induced DNA damage.
15955450 2005 The hepatitis B virus X protein up-regulates lymphotoxin alpha expression in hepatocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12773388 2003 HBXIP functions as a cofactor of survivin in apoptosis suppression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11925594 2002 Applying a highly specific and reproducible cDNA RDA method to clone garlic up-regulated genes in human gastric cancer cells.
11788598 2002 Hepatitis B virus pX interacts with HBXAP, a PHD finger protein to coactivate transcription.
9499022 1998 Cloning and characterization of a novel hepatitis B virus x binding protein that inhibits viral replication.