Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.24
PubTator Score 5.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.386 7.0e-04
pancreatic cancer 1.300 6.3e-04

Protein-protein Interaction (10)

Gene RIF (6)

PMID Text
26032166 Data suggest that ablation of p18/LAMTOR1 suppresses starvation-induced cell death by stimulating autophagy through modulation of p27(kip1) activity.
22513874 LAMTOR1 expression affects the tuning of lysosomal activation that can lead to p53-dependent apoptosis through excessive catabolism.
21087931 A p27(kip1)-binding protein, p27RF-Rho, promotes cancer metastasis via activation of RhoA and RhoC.
20381137 A complex encoded by the MAPKSP1, ROBLD3, and c11orf59 genes interacts with the Rag GTPases, recruits them to lysosomes, and is essential for mTORC1 activation
19654316 MT1-MMP-associated protein p27RF-Rho binds p27(kip1) and prevents p27(kip1) from binding to RhoA. [p27RF-Rho]
19177150 Studies in rat and mice, identified the rat p18 protein as an endosomal membrane anchoring protein which interacts with MEK1 scaffold p14/MP1 and mobilizes them to late endosome.

AA Sequence

MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSA      1 - 70
ADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLASEPIPFSDLQQVSRIAAYAY     71 - 140
SALSQIRVDAKEELVVQFGIP                                                     141 - 161
//

Text Mined References (30)

PMID Year Title
26032166 2015 Depletion of p18/LAMTOR1 promotes cell survival via activation of p27(kip1) -dependent autophagy under starvation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22980980 2012 Ragulator is a GEF for the rag GTPases that signal amino acid levels to mTORC1.
22513874 2012 LAMTOR1 depletion induces p53-dependent apoptosis via aberrant lysosomal activation.
21269460 2011 Initial characterization of the human central proteome.
21087931 2011 A p27(kip1)-binding protein, p27RF-Rho, promotes cancer metastasis via activation of RhoA and RhoC.
20544018 2010 Pdro, a protein associated with late endosomes and lysosomes and implicated in cellular cholesterol homeostasis.
20381137 2010 Ragulator-Rag complex targets mTORC1 to the lysosomal surface and is necessary for its activation by amino acids.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19654316 2009 A novel protein associated with membrane-type 1 matrix metalloproteinase binds p27(kip1) and regulates RhoA activation, actin remodeling, and matrigel invasion.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19177150 2009 The novel lipid raft adaptor p18 controls endosome dynamics by anchoring the MEK-ERK pathway to late endosomes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.