Property Summary

NCBI Gene PubMed Count 38
PubMed Score 54.45
PubTator Score 151.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
Multiple myeloma 2.496 2.3e-03
malignant mesothelioma -1.300 4.1e-06
psoriasis 2.200 2.1e-43
cutaneous lupus erythematosus 2.300 1.2e-04
osteosarcoma -1.516 6.5e-03
glioblastoma 1.600 1.0e-04
atypical teratoid / rhabdoid tumor 1.900 6.5e-05
Atopic dermatitis 1.600 6.8e-04
adrenocortical carcinoma 1.100 2.1e-02
tuberculosis and treatment for 3 months -1.700 1.0e-03
pancreatic ductal adenocarcinoma liver m... 1.400 3.7e-02
non-small cell lung cancer -2.807 9.5e-21
intraductal papillary-mucinous carcinoma... -1.300 3.1e-02
lung cancer -8.000 4.5e-08
active Crohn's disease 1.557 8.0e-03
diabetes mellitus 1.700 1.9e-03
Multiple Sclerosis 2.400 3.0e-02
interstitial cystitis 3.200 2.1e-04
cystic fibrosis 2.100 1.6e-03
lung adenocarcinoma -3.500 3.3e-12
pediatric high grade glioma 1.200 6.2e-04
primary Sjogren syndrome 2.200 3.0e-04
acute myeloid leukemia 1.900 4.4e-02
invasive ductal carcinoma 2.500 2.6e-03
inflammatory breast cancer 1.500 4.7e-02
lung carcinoma -7.100 1.5e-42
breast carcinoma 1.200 6.1e-17
spina bifida -1.288 4.0e-02
ductal carcinoma in situ 2.800 1.2e-03
ulcerative colitis 3.300 7.7e-08
ovarian cancer 1.700 3.8e-03

 CSPA Cell Line (4)

Gene RIF (30)

PMID Text
26263981 our results suggest that epithelial LAMP3 expression is an independent prognostic biomarker for esophageal squamous cell carcinoma .
26191259 In laryngeal squamous cell carcinoma, high LAMP3 and high TP53 protein expression was significantly associated with tumor stage and size and patients with high expression of these proteins had poor overall survival.
25681212 LAMP3 regulation as part of the unfolded protein response contributes to protein degradation and cell survival during proteasomal dysfunction.
25362357 LAMP3 and TP53 protein expression was significantly higher in cancerous gastrointestinal tissues compared to normal and benign tissues; only LAMP3 expression correlated with poor overall survival
24634103 LAMP3 gene expression is relevant for prognosis in squamous cell carcinoma of head and neck.
24631562 the MCCC1/LAMP3 gene can decrease the risk of Parkinson disease in Chinese population.
24434718 LAMP3 knockdown in MCF7 breast cancer cells increases tamoxifen sensitivity.
24162774 HIV-1 gp120 downregulates the expression of lysosomal-associated membrane protein 3 (LAMP3) in human B cells
24081865 Increase in CD208+ dendritic cells in tonsils is associated with immunoglobulin A nephropathy
24045183 the association between hypoxia, metastasis, and poor prognosis is due, in part, to hypoxic activation of the unfolded protein response and expression of LAMP3.
23898208 HIV-1 gp120 downregulates the expression of lysosomal-associated membrane protein 3 (LAMP3) in human B cells
23876802 These results suggest that Treg-DC interactions may promote chronic H. pylori infection by rendering gastric DCs tolerogenic.
23651994 LAMP3 is a driver of interferon related genes as demonstrated by siRNA experiments and by gene expression in cervical carcer samples.
23569139 DC-LAMP and DC-SIGN may be involved in the pathogenesis of condyloma acuminatum.
23294542 the PERK/ATF4/LAMP3-arm of the UPR is an additional pathway mediating hypoxia-induced breast cancer cell migration
22809326 The crystal structure of the conserved domain of human DC-LAMP was solved.
21810281 LAMP3 is an influenza A virus inducible gene, and plays an important role in viral post-entry steps.
21596034 Both DC-LAMP and DC-SIGN proteins may be involved in the pathogenesis of psoriasis vulgaris.
21319150 In the current breast cancer cohorts, LAMP3 had independent prognostic value.
20863830 Data show that the ABCA3 N-terminus is proteolytically removed inside acidic LAMP3-positive vesicles MVB/LB.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20414141 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19335688 Because a defect of the granular layer in psoriatic lesions has been recognized, increased expression of lysosome-related CD208 in the basal and suprabasal keratinocytes of psoriatic lesions might represent aberrant epidermal differentiation.
19308021 Observational study of gene-disease association. (HuGE Navigator)
18292234 In rheumatoid arthritis patients, the number of CD304(+) plasmacytoid DCs (pDCs) exceeded that of CD1c(+) myeloid DCs (mDCs), with the majority of infiltrating DCs being CD83(-) or DC-LAMP(-).
17606713 DC-LAMP has a role in preventing the progression of micrometastatic melanoma in lymph nodes
17056097 DC-LAMP staining was lost in solid type adenocarcinomas but persisted in well-differentiated areas and there was no prognostic difference in tumors that reacted with DC-LAMP.
16887987 LAMP-1 and DC-LAMP antigen chimeras follow different trafficking pathways, induce distinct modulatory immune responses, and are able to present cryptic epitopes.
16204031 Findings indicate that LAMP3 overexpression is associated with an enhanced metastatic potential and may be a prognostic factor for cervical cancer.

AA Sequence

MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMD      1 - 70
GHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITP     71 - 140
PAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPAST    141 - 210
VPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSN    211 - 280
LLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAH    281 - 350
LQVKTTDVQLQAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI        351 - 416
//

Text Mined References (39)

PMID Year Title
26263981 2015 High Expression of LAMP3 Is a Novel Biomarker of Poor Prognosis in Patients with Esophageal Squamous Cell Carcinoma.
26191259 2015 LAMP3 and TP53 overexpression predicts poor outcome in laryngeal squamous cell carcinoma.
25681212 Loss of lysosome-associated membrane protein 3 (LAMP3) enhances cellular vulnerability against proteasomal inhibition.
25362357 2014 Prognostic value of LAMP3 and TP53 overexpression in benign and malignant gastrointestinal tissues.
24634103 2015 Hypoxic regulation of the PERK/ATF4/LAMP3-arm of the unfolded protein response in head and neck squamous cell carcinoma.
24631562 2014 Association analysis of STK39, MCCC1/LAMP3 and sporadic PD in the Chinese Han population.
24434718 2014 LAMP3 is involved in tamoxifen resistance in breast cancer cells through the modulation of autophagy.
24081865 2013 Clinical and immunological implications of increase in CD208+ dendritic cells in tonsils of patients with immunoglobulin A nephropathy.
24045183 2013 Hypoxic activation of the PERK/eIF2? arm of the unfolded protein response promotes metastasis through induction of LAMP3.
23876802 2013 DC-LAMP+ dendritic cells are recruited to gastric lymphoid follicles in Helicobacter pylori-infected individuals.
23651994 2013 Gene network reconstruction reveals cell cycle and antiviral genes as major drivers of cervical cancer.
23569139 2013 Expression of dendritic cell lysosome-associated membrane protein and dendritic cell-specific intercellular adhesion molecule-3 grabbing nonintegrin in condyloma acuminatum lesions.
23294542 2013 Hypoxia stimulates migration of breast cancer cells via the PERK/ATF4/LAMP3-arm of the unfolded protein response.
22809326 2012 Crystal structure of the conserved domain of the DC lysosomal associated membrane protein: implications for the lysosomal glycocalyx.
21930964 2011 Reciprocal polarization of T and B cells at the immunological synapse.
21810281 2011 Lysosome-associated membrane glycoprotein 3 is involved in influenza A virus replication in human lung epithelial (A549) cells.
21738487 2011 Web-based genome-wide association study identifies two novel loci and a substantial genetic component for Parkinson's disease.
21596034 2011 Significance of DC-LAMP and DC-SIGN expression in psoriasis vulgaris lesions.
21319150 2011 Hypoxic regulation and prognostic value of LAMP3 expression in breast cancer.
21292315 2011 Imputation of sequence variants for identification of genetic risks for Parkinson's disease: a meta-analysis of genome-wide association studies.
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
20863830 2010 The surfactant lipid transporter ABCA3 is N-terminally cleaved inside LAMP3-positive vesicles.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20414141 2010 Family-based association study for bipolar affective disorder.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19335688 2009 Increased expression of CD208 (DC-LAMP) in epidermal keratinocytes of psoriatic lesions.
19308021 2009 Findings from bipolar disorder genome-wide association studies replicate in a Finnish bipolar family-cohort.
18292234 2008 Rheumatoid arthritis synovium contains two subsets of CD83-DC-LAMP- dendritic cells with distinct cytokine profiles.
17606713 2007 Long-term protective effect of mature DC-LAMP+ dendritic cell accumulation in sentinel lymph nodes containing micrometastatic melanoma.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
17056097 2007 DC-LAMP stains pulmonary adenocarcinoma with bronchiolar Clara cell differentiation.
16887987 2006 Dendritic cell-lysosomal-associated membrane protein (LAMP) and LAMP-1-HIV-1 gag chimeras have distinct cellular trafficking pathways and prime T and B cell responses to a diverse repertoire of epitopes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16204031 2005 Overexpression of LAMP3/TSC403/DC-LAMP promotes metastasis in uterine cervical cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15111122 2004 Human dendritic cell lysosome-associated membrane protein expressed in lung type II pneumocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9768752 1998 A novel lysosome-associated membrane glycoprotein, DC-LAMP, induced upon DC maturation, is transiently expressed in MHC class II compartment.
9721848 1998 Isolation and characterization of a novel human lung-specific gene homologous to lysosomal membrane glycoproteins 1 and 2: significantly increased expression in cancers of various tissues.