Property Summary

NCBI Gene PubMed Count 119
PubMed Score 343.69
PubTator Score 262.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Glycogen Storage Disease Type IIb 1 0.0 0.0
Status Epilepticus 98 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Glycogen storage disease 39 4.266 2.1
Disease Target Count
Danon disease 8

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.083 1.7e-05
Astrocytoma, Pilocytic 1.200 2.4e-04
dermatomyositis 1.500 1.6e-03
Down syndrome 1.600 7.1e-04
glioblastoma 1.400 3.5e-02
group 4 medulloblastoma -1.600 3.0e-03
juvenile dermatomyositis 1.040 8.9e-08
lung cancer -1.900 6.3e-03
malignant mesothelioma -1.900 7.3e-08
medulloblastoma, large-cell -1.400 1.6e-02
Multiple myeloma 1.495 9.0e-04
ovarian cancer -1.400 4.3e-04
pancreatic ductal adenocarcinoma liver m... -2.105 8.0e-03
pediatric high grade glioma 1.300 3.0e-03
psoriasis 1.200 1.5e-03
subependymal giant cell astrocytoma 1.940 2.7e-02
tuberculosis 1.500 4.9e-07
Waldenstrons macroglobulinemia 1.125 4.5e-02

 OMIM Phenotype (1)

Gene RIF (76)

AA Sequence

MVCFRLFPVPGSGLVLVCLVLGAVRSYALELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHG      1 - 70
TVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDEL     71 - 140
LAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTT    141 - 210
TPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIK    211 - 280
YLDFVFAVKNENRFYLKEVNISMYLVNGSVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDL    281 - 350
RVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF              351 - 410
//

Text Mined References (126)

PMID Year Title