Property Summary

NCBI Gene PubMed Count 79
PubMed Score 53.63
PubTator Score 49.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (30)

Disease log2 FC p
Multiple myeloma 1.278 9.8e-03
malignant mesothelioma -1.900 7.5e-08
glioblastoma 2.700 1.8e-03
osteosarcoma 1.371 9.0e-03
posterior fossa group A ependymoma 1.500 3.4e-10
astrocytoma 2.200 5.2e-03
atypical teratoid / rhabdoid tumor 2.500 5.4e-06
sonic hedgehog group medulloblastoma 1.500 2.6e-04
medulloblastoma, large-cell 1.600 1.1e-05
primitive neuroectodermal tumor 1.300 3.1e-03
Duchenne muscular dystrophy 1.164 7.9e-07
autosomal dominant Emery-Dreifuss muscul... 1.008 9.7e-03
juvenile dermatomyositis 1.184 1.1e-10
acute quadriplegic myopathy 1.001 6.0e-04
primary pancreatic ductal adenocarcinoma 1.962 3.3e-03
non-small cell lung cancer 1.102 7.2e-17
lung cancer 1.300 7.7e-05
breast carcinoma -1.600 1.6e-04
fibroadenoma -1.300 5.0e-02
pediatric high grade glioma 1.900 5.1e-05
pilocytic astrocytoma 1.300 5.4e-05
subependymal giant cell astrocytoma 1.198 2.1e-02
nasopharyngeal carcinoma 1.100 7.5e-04
gastric carcinoma 1.500 8.1e-03
ductal carcinoma in situ -1.200 7.3e-03
invasive ductal carcinoma -2.000 3.6e-04
ulcerative colitis 2.000 1.9e-04
ovarian cancer 1.200 3.8e-02
pancreatic cancer 1.900 5.3e-03
dermatomyositis 1.100 9.6e-03

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (42)

PMID Text
26343160 LAMC1 may contribute to the development and progression of uterine carcinoma, likely through enhancing tumor cell motility and invasion.
26074471 Case Report: Anti-laminin-gamma 1 pemphigoid in patient with generalized pustular psoriasis and psoriasis vulgaris.
26052614 The identification of laminin gamma 1 (LAMC1) and myeloid cell leukemia 1 (MCL1) as direct targets of miR-22 and miR-29a, respectively, suggested a tumor-suppressive role of these miRNAs.
24951930 Laminins 411 and 421 differentially promote tumor cell migration via alpha6beta1 integrin and MCAM (CD146).
24820027 Data showed that LAMC1 expression is directly regulated by miR-29s.
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24733442 Case Report: occurrence of anti-laminin-gamma1 pemphigoid in a case of autosomal recessive congenital ichthyosis.
24300951 These findings document a pathogenic potential of antibodies targeting the laminin gamma1 N-terminus.
24180678 carbohydrate moiety (alpha-Gal) on laminin gamma-1 and collagen alpha-1 (VI) chain are possibly common IgE-reactive proteins in the Japanese patients with beef allergy
23674478 results demonstrate that mutation in either NID1 or LAMC1 disrupts the interaction NID1-LAMC1 complex; findings implicate the extracellular matrix in the pathogenesis of Dandy-Walker spectrum disorders
23266556 Genetic polymorphism of LAMC1 gene is associated in the pathogenesis of colorectal cancers.
23053286 Results suggest that laminin gamma1 expression is associated with meningioma grades and could play a role in enhancing tumor invasion.
23039241 LAMC1 polymorphism could be a protective factor for SLE.
22968451 Letter: a small but distinct subgroup of both systemic and cutaneous lupus erythematosus patients has antibodies against the C-terminus of laminin gamma1.
22911854 Autoantibodies in anti-p200 pemphigoid sera are pathogenic while pathogenicity is not mediated by autoantibodies against laminin gamma1.
22892598 Overexpression of laminin gamma1 immunoreactivity and alteration of its staining pattern may serve as a useful biomarker in serous tubal intraepithelial carcinoma.
22377151 Mutations in the coding sequence of LAMC1 and DLGH1 may not be associated with Mayer-Rokitansky-Kuster-Hauser Syndrome.
22342894 Single-nucleotide polymorphisms (SNPs) representing 99% coverage of LAMC1 were genotyped. There was no association between SNP rs10911193 and advanced pelvic organ prolapse. There was a trend toward significance for SNPs rs1413390, rs20563, and rs20558.
22321639 LAMC1 is significantly associated with premature ovarian failure, and specifically, possession of at least one HT1 was associated with susceptibility to premature ovarian failure.
21276136 results suggest that Lm3B11/3B21 may be required for normal mature vessels and interfere with tumor angiogenesis
21192846 Laminin-5 gamma2 chain and SPARC may play roles in the progression of esophageal squamous cell carcinoma and their simultaneous expression is correlated with poorer prognosis.
20688161 The nano-structure of the laminin gamma-1 short arm was determined. In solution, it adapts an extended conformation.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20223449 Several LAMC1 single nucleotide polymorphisms exist with significant differences between African American and Caucasian women, but no association found between any LAMC1 variant and advanced pelvic organ prolapse.
20223449 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19416897 laminin-111 (alpha(1), beta(1), gamma(1)), which is expressed during embryonic development but absent in normal or dystrophic skeletal muscle, increased alpha(7)-integrin expression in mouse and DMD patient myoblasts
18697739 Laminin isoforms containing the gamma3 chain are unable to bind to integrins due to the absence of the glutamic acid residue conserved in the C-terminal regions of the gamma1 and gamma2 chains
18073332 In embryonic stem cells deficient in laminins, due to lamc1 (laminin gamma1) deletion, vascular development and organization were largely unaffected.
17554784 gamma1 laminin is selectively overexpressed in reactive astrocytes of the amyotrophic lateral sclerosis spinal cord
17021862 a polymorphism in the promoter of LAMC1 may increase the susceptibility to early-onset pelvic organ prolapse
16146715 laminin isoform changes are associated with brain tumor invasion and angiogenesis [review]
15967115 prostate cancer cells expressing high levels of MT1-MMP have increased invasive potential through their ability to degrade and invade Ln-10 barriers
15561105 Expression of LAMC1 in glioblastoma is inhibited by indomethacin. Indomethacin inhibits cyclooxygenases and is an NSAID drug.
15370542 Observational study of gene-disease association. (HuGE Navigator)
15159456 Basement membrane formation is inhibited by a nidogen-laminin gamma1-chain fragment in skin-organotypic cultures.
12743034 Data suggest that laminin-10 (alpha5beta1gamma1) is required for hair follicle development and report the first use of exogenous protein to correct a cutaneous developmental defect.
12615822 mRNA encoding laminin-alpha1, -beta1, and -gamma1 chains was expressed in 90% of endometriotic lesions.
12526023 The neurite outgrowth domain of gamma 1 laminin accumulates heavily in the floor plate region, in the notochord and in GFAP-immunoreactive glial fibers of the embryonic spinal cord.
12111806 Enhanced and specialized expression patterns of alpha 1 and gamma 1 laminins distinctly associate these two laminins with the Alzheimer disease.
11891225 Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways (Laminin 10; separate entry for Laminin 11).
11311202 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution

AA Sequence

MRGSHRAAPALRPRGRLWPVLAVLAAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCG      1 - 70
TPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLG     71 - 140
KAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDEFS    141 - 210
DISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDF    211 - 280
AVGGRCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQE    281 - 350
CYFDPELYRSTGHGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSSCHCSPVGSLSTQCDSYGRCSCKP    351 - 420
GVMGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNIETGRCVCKDNVEGFNCERCKPGFFNLESSNPR    421 - 490
GCTPCFCFGHSSVCTNAVGYSVYSISSTFQIDEDGWRAEQRDGSEASLEWSSERQDIAVISDSYFPRYFI    491 - 560
APAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSYPSETTVKYVFRLHEA    561 - 630
TDYPWRPALTPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQF    631 - 700
CEMCLSGYRRETPNLGPYSPCVLCACNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDC    701 - 770
QPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCSDNIDPNAVG    771 - 840
NCNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPH    841 - 910
VTGQDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCERCEVNHFGFGPEGC    911 - 980
KPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFYNRSWPGCQECPACYRLVKDKVADHRVKLQ    981 - 1050
ELESLIANLGTGDEMVTDQAFEDRLKEAEREVMDLLREAQDVKDVDQNLMDRLQRVNNTLSSQISRLQNI   1051 - 1120
RNTIEETGNLAEQARAHVENTERLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERH   1121 - 1190
KQEADDIVRVAKTANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRA   1191 - 1260
GDKAVEIYASVAQLSPLDSETLENEANNIKMEAENLEQLIDQKLKDYEDLREDMRGKELEVKNLLEKGKT   1261 - 1330
EQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNKTAAEEALRKIPAINQTITE   1331 - 1400
ANEKTREAQQALGSAAADATEAKNKAHEAERIASAVQKNATSTKAEAERTFAEVTDLDNEVNNMLKQLQE   1401 - 1470
AEKELKRKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEG   1471 - 1540
TLNKAKDEMKVSDLDRKVSDLENEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP    1541 - 1609
//

Text Mined References (87)

PMID Year Title
26343160 2015 Laminin C1 expression by uterine carcinoma cells is associated with tumor progression.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26074471 2016 Anti-laminin-gamma 1 Pemphigoid with Generalized Pustular Psoriasis and Psoriasis Vulgaris.
26052614 2015 miR-22 and miR-29a Are Members of the Androgen Receptor Cistrome Modulating LAMC1 and Mcl-1 in Prostate Cancer.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24951930 2014 Laminins 411 and 421 differentially promote tumor cell migration via ?6?1 integrin and MCAM (CD146).
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24820027 2014 Tumor-suppressive microRNA-29s inhibit cancer cell migration and invasion via targeting LAMC1 in prostate cancer.
24733442 2015 Anti-laminin-?1 pemphigoid developed in a case of autosomal recessive congenital ichthyosis.
24300951 2014 Ex vivo pathogenicity of anti-laminin ?1 autoantibodies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24180678 2014 Laminin ?-1 and collagen ?-1 (VI) chain are galactose-?-1,3-galactose-bound allergens in beef.
23674478 2013 Mutations in extracellular matrix genes NID1 and LAMC1 cause autosomal dominant Dandy-Walker malformation and occipital cephaloceles.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
23053286 2013 Association between laminin ?1 expression and meningioma grade, recurrence, and progression-free survival.
23039241 2013 Laminin-1 (LM-111) in preeclampsia and systemic lupus erythematosus.
22968451 2012 Antibodies to the C-terminus of laminin ?1 are present in a distinct subgroup of patients with systemic and cutaneous lupus erythematosus.
22952693 2012 Cleavage of nidogen-1 by cathepsin S impairs its binding to basement membrane partners.
22911854 2012 Pathogenicity of autoantibodies in anti-p200 pemphigoid.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22892598 2012 The diagnostic and biological implications of laminin expression in serous tubal intraepithelial carcinoma.
22377151 2012 Polymorphisms in DLGH1 and LAMC1 in Mayer-Rokitansky-Kuster-Hauser syndrome.
22342894 2012 Comprehensive analysis of LAMC1 genetic variants in advanced pelvic organ prolapse.
22321639 2012 LAMC1 gene is associated with premature ovarian failure.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21276136 2011 Downregulation of a newly identified laminin, laminin-3B11, in vascular basement membranes of invasive human breast cancers.
21269460 2011 Initial characterization of the human central proteome.
21192846 2011 Expressions of the ?2 chain of laminin-5 and secreted protein acidic and rich in cysteine in esophageal squamous cell carcinoma and their relation to prognosis.
20688161 2010 Nano-structure of the laminin ?-1 short arm reveals an extended and curved multidomain assembly.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20223449 2010 Is laminin gamma-1 a candidate gene for advanced pelvic organ prolapse?
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19416897 2009 Laminin-111 protein therapy prevents muscle disease in the mdx mouse model for Duchenne muscular dystrophy.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18697739 2008 Laminin isoforms containing the gamma3 chain are unable to bind to integrins due to the absence of the glutamic acid residue conserved in the C-terminal regions of the gamma1 and gamma2 chains.
18073332 2008 Laminin deposition is dispensable for vasculogenesis but regulates blood vessel diameter independent of flow.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17554784 2007 Selective overexpression of gamma1 laminin in astrocytes in amyotrophic lateral sclerosis indicates an involvement in ALS pathology.
17021862 2007 Sequence variant in the laminin gamma1 (LAMC1) gene associated with familial pelvic organ prolapse.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16236823 2006 Laminin-10 and Lutheran blood group glycoproteins in adhesion of human endothelial cells.
16146715 2006 Changes in laminin isoforms associated with brain tumor invasion and angiogenesis.
15967115 2005 Membrane type 1 matrix metalloprotease cleaves laminin-10 and promotes prostate cancer cell migration.
15561105 2005 The cyclooxygenase inhibitor indomethacin modulates gene expression and represses the extracellular matrix protein laminin gamma1 in human glioblastoma cells.
15370542 2004 Evaluation of the ARMD1 locus on 1q25-31 in patients with age-related maculopathy: genetic variation in laminin genes and in exon 104 of HEMICENTIN-1.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15159456 2004 Inhibition of basement membrane formation by a nidogen-binding laminin gamma1-chain fragment in human skin-organotypic cocultures.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14557481 2003 Laminin isoforms in fetal and adult human adrenal cortex.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12743034 2003 Laminin-10 is crucial for hair morphogenesis.
12615822 2003 An association of IgG anti-laminin-1 autoantibodies with endometriosis in infertile patients.
12526023 2003 Gamma 1 laminin and its biologically active KDI-domain may guide axons in the floor plate of human embryonic spinal cord.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12111806 2002 Differential distribution of laminins in Alzheimer disease and normal human brain tissue.
11891225 2002 Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways.
11311202 2001 Amplification of extracellular matrix and oncogenes in tat-transfected human salivary gland cell lines with expression of laminin, fibronectin, collagens I, III, IV, c-myc and p53.
11133776 2001 Lutheran blood group glycoprotein and its newly characterized mouse homologue specifically bind alpha5 chain-containing human laminin with high affinity.
11067943 2000 Monocytic cells synthesize, adhere to, and migrate on laminin-8 (alpha 4 beta 1 gamma 1).
11054877 2000 Integrins as receptors for laminins.
10964500 2000 Posttranslational modifications and beta/gamma chain associations of human laminin alpha1 and laminin alpha5 chains: purification of laminin-3 from placenta.
10671376 2000 Integrin binding specificity of laminin-10/11: laminin-10/11 are recognized by alpha 3 beta 1, alpha 6 beta 1 and alpha 6 beta 4 integrins.
9885251 1999 Absence of basement membranes after targeting the LAMC1 gene results in embryonic lethality due to failure of endoderm differentiation.
9755123 1998 Inducible transcriptional activity of bcn-1 element from laminin gamma1-chain gene promoter in renal and nonrenal cells.
9733643 1998 Nidogen-2: a new basement membrane protein with diverse binding properties.
9647658 1998 The laminin-nidogen complex is a ligand for a specific splice isoform of the transmembrane protein tyrosine phosphatase LAR.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7921537 1994 A new nomenclature for the laminins.
7698745 1994 Human beta 2 chain of laminin (formerly S chain): cDNA cloning, chromosomal localization, and expression in carcinomas.
3552045 1987 Structure of human tumor necrosis factor alpha derived from recombinant DNA.
3402995 1988 cDNA cloning, expression and mapping of human laminin B2 gene to chromosome 1q31.
3360804 1988 Human laminin B2 chain. Comparison of the complete amino acid sequence with the B1 chain reveals variability in sequence homology between different structural domains.
3234037 1988 Isolation of a human laminin B2 (LAMB2) cDNA clone and assignment of the gene to chromosome region 1q25----q31.
2922051 1989 A laminin-like adhesive protein concentrated in the synaptic cleft of the neuromuscular junction.
1985895 1991 Structure of the human laminin B2 chain gene reveals extensive divergence from the laminin B1 chain gene.
1806043 1991 Differences in human laminin B2 sequences.