Property Summary

NCBI Gene PubMed Count 73
PubMed Score 76.79
PubTator Score 69.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (31)

Disease log2 FC p
malignant mesothelioma -1.400 4.9e-07
oligodendroglioma -1.400 3.3e-02
psoriasis -2.100 4.0e-03
glioblastoma multiforme 2.400 7.2e-14
sonic hedgehog group medulloblastoma 2.500 7.1e-06
medulloblastoma, large-cell 2.600 4.1e-04
Duchenne muscular dystrophy 2.009 2.2e-09
autosomal dominant Emery-Dreifuss muscul... 1.470 4.3e-03
juvenile dermatomyositis 2.043 8.7e-12
acute quadriplegic myopathy 1.140 8.2e-04
primary pancreatic ductal adenocarcinoma 1.477 4.7e-02
intraductal papillary-mucinous adenoma (... -1.900 1.5e-02
intraductal papillary-mucinous neoplasm ... -1.600 4.2e-02
active Crohn's disease 1.578 7.1e-03
active ulcerative colitis 1.424 6.1e-03
diabetes mellitus -1.300 2.7e-02
cystic fibrosis 1.200 2.2e-03
pediatric high grade glioma 1.400 9.4e-03
pilocytic astrocytoma 1.100 2.5e-02
non primary Sjogren syndrome sicca 1.200 2.1e-02
acute myeloid leukemia -1.400 4.9e-02
lung adenocarcinoma -1.100 2.7e-04
nasopharyngeal carcinoma 2.800 3.9e-07
lung carcinoma -1.400 1.8e-07
Breast cancer 1.100 4.3e-04
gastric carcinoma 1.400 3.7e-02
pterygium -1.100 2.2e-02
ovarian cancer -4.400 2.3e-08
pituitary cancer -1.300 1.9e-02
pancreatic cancer 1.400 2.8e-02
dermatomyositis 1.900 7.9e-03

 OMIM Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (33)

PMID Text
26359947 LAMB1 is a potential serological biomarker that could be used in conjunction with carcinoembryonic antigen for diagnosis of colorectal cancer.
26057585 These results suggest that MUC5B production can be regulated by ECM components and that MUC5B is upregulated by fibronectin and laminin via the integrin, ERK, and NF-kappaB dependent pathway.
25774865 An association was found between LAMB1 rs2158836 polymorphisms and symptom severity in Korean autism spectrum disorder patients.
25664710 LAMB1 single nucleotide polymorphism rs886774 was associated with early onset Ulcerative colitis and, thus, suggests a fundamentally different mechanism of early disease pathogenesis in Ulcerative colitis versus Crohn's disease.
24951930 Laminins 411 and 421 differentially promote tumor cell migration via alpha6beta1 integrin and MCAM (CD146).
24804215 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24497408 Upregulation of LAMB1 expression was highly correlated with the downregulation of miR-124-5p. LAMB1 protein expression was suppressed by miR-124-5p.
23679161 The phenotype due to LAMB2 mutations appears to be similar between different ethnic groups.
23472759 Homozygous deleterious mutations in LAMB1.
21744425 We did not find an association of rs6949033 (LAMB1) with ulcerative colitis.
21370991 Laminin beta1 and integrin alpha2 expression is elevated in the anterior temporal neocortex tissue from patients with intractable epilepsy.
21276136 results suggest that Lm3B11/3B21 may be required for normal mature vessels and interfere with tumor angiogenesis
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19915572 LAMB1 new susceptibility loci for ulcerative colitis
19915572 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19526105 The presence of nuclear beta-catenin and high content of mmp-9 in the tumor were associated with abnormal accumulation of laminin in the cytoplasm. These changes were characteristic of colorectal cancer with high invasive metastatic potential.
19416897 laminin-111 (alpha(1), beta(1), gamma(1)), which is expressed during embryonic development but absent in normal or dystrophic skeletal muscle, increased alpha(7)-integrin expression in mouse and DMD patient myoblasts
19147489 beta2 chain-containing laminins (beta2-laminins) bound more avidly to alpha3beta1 and alpha7X2beta1 integrins than beta1 chain-containing laminins (beta1-laminins).
19058789 Observational study of gene-disease association. (HuGE Navigator)
18691630 Elevated expression of laminin beta1 mRNA and protein in the hippocampus suggests that laminin beta1 may play a role in the development of epileptic seizures in patients with intractable epilepsy.
18474427 Meningiomas increase in size through increased production of extracellular matrix; furthermore, the proliferation of cells typically associated with neoplasia requires considerable interaction with the extracellular matrix.
18450753 laminin supports platelet adhesion depending on the interaction of VWF and GPIb-IX-V under pathophysiological high shear flow
18162078 Real-time PCR showed that ETOH significantly altered the expression of genes involved in cell adhesion. There was an increase in the expression of alpha and beta Laminins 1, beta Integrins 3 and 5, Secreted phosphoprotein1 and Sarcoglycan epsilon.
16146715 laminin isoform changes are associated with brain tumor invasion and angiogenesis [review]
15987446 laminin beta1 chain (a constituent of laminin-8) was typically found in vessel walls of carcinomas and their metastases but not in those of normal breast
15967115 prostate cancer cells expressing high levels of MT1-MMP have increased invasive potential through their ability to degrade and invade Ln-10 barriers
15706419 alteration of LAMB1 expression is associated with the genesis and development of uterine leiomyoma
12743034 Data suggest that laminin-10 (alpha5beta1gamma1) is required for hair follicle development and report the first use of exogenous protein to correct a cutaneous developmental defect.
12615822 mRNA encoding laminin-alpha1, -beta1, and -gamma1 chains was expressed in 90% of endometriotic lesions.
11891225 Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways (Laminin 10; separate entry for Laminin 11).
11311202 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution

AA Sequence

MGLLQLLAFSFLALCRARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHL      1 - 70
QEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEFHFTHLIMTF     71 - 140
KTFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRAL    141 - 210
DPAFKIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASEC    211 - 280
APVDGFNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEHSISCHFDMAV    281 - 350
YLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPNFCERCTCDPAGSQNEGICDSYTDFSTG    351 - 420
LIAGQCRCKLNVEGEHCDVCKEGFYDLSSEDPFGCKSCACNPLGTIPGGNPCDSETGHCYCKRLVTGQHC    421 - 490
DQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCFAESGQCSCRPHMIGRQCNEVEPGYYFATLDHYLYEAE    491 - 560
EANLGPGVSIVERQYIQDRIPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVIT    561 - 630
VQRPGRIPTSSRCGNTIPDDDNQVVSLSPGSRYVVLPRPVCFEKGTNYTVRLELPQYTSSDSDVESPYTL    631 - 700
IDSLVLMPYCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTG    701 - 770
LACECDPQGSLSSVCDPNGGQCQCRPNVVGRTCNRCAPGTFGFGPSGCKPCECHLQGSVNAFCNPVTGQC    771 - 840
HCFQGVYARQCDRCLPGHWGFPSCQPCQCNGHADDCDPVTGECLNCQDYTMGHNCERCLAGYYGDPIIGS    841 - 910
GDHCRPCPCPDGPDSGRQFARSCYQDPVTLQLACVCDPGYIGSRCDDCASGYFGNPSEVGGSCQPCQCHN    911 - 980
NIDTTDPEACDKETGRCLKCLYHTEGEHCQFCRFGYYGDALQQDCRKCVCNYLGTVQEHCNGSDCQCDKA    981 - 1050
TGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDPCNCNAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQEL   1051 - 1120
FWGDPDVECRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVII   1121 - 1190
AELTNRTHRFLEKAKALKISGVIGPYRETVDSVERKVSEIKDILAQSPAAEPLKNIGNLFEEAEKLIKDV   1191 - 1260
TEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSITKYFQMSLE   1261 - 1330
AEERVNASTTEPNSTVEQSALMRDRVEDVMMERESQFKEKQEEQARLLDELAGKLQSLDLSAAAEMTCGT   1331 - 1400
PPGASCSETECGGPNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDVLSALAEVEQLSKMVSEAKL   1401 - 1470
RADEAKQSAEDILLKTNATKEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQL   1471 - 1540
QNLTEDIRERVESLSQVEVILQHSAADIARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQVAAE   1541 - 1610
KAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVK   1611 - 1680
QSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDN   1681 - 1750
QRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL                                     1751 - 1786
//

Text Mined References (79)

PMID Year Title
26359947 2015 Analysis of colorectal cancer glyco-secretome identifies laminin ?-1 (LAMB1) as a potential serological biomarker for colorectal cancer.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26057585 2015 MUC5B mucin production is upregulated by fibronectin and laminin in human lung epithelial cells via the integrin and ERK dependent pathway.
25774865 2015 LAMB1 polymorphism is associated with autism symptom severity in Korean autism spectrum disorder patients.
25664710 2015 Genetic determinants associated with early age of diagnosis of IBD.
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
24951930 2014 Laminins 411 and 421 differentially promote tumor cell migration via ?6?1 integrin and MCAM (CD146).
24804215 2014 Extracellular matrix proteins expression profiling in chemoresistant variants of the A2780 ovarian cancer cell line.
24497408 2014 MiR-124-5p inhibits the growth of high-grade gliomas through posttranscriptional regulation of LAMB1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23679161 2013 First Japanese case of Pierson syndrome with mutations in LAMB2.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23472759 2013 Mutations in LAMB1 cause cobblestone brain malformation without muscular or ocular abnormalities.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21744425 2011 HNF4? and CDH1 are associated with ulcerative colitis in a Dutch cohort.
21370991 2011 Expression of laminin ?1 and integrin ?2 in the anterior temporal neocortex tissue of patients with intractable epilepsy.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21276136 2011 Downregulation of a newly identified laminin, laminin-3B11, in vascular basement membranes of invasive human breast cancers.
21269460 2011 Initial characterization of the human central proteome.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19915572 2009 Genome-wide association study of ulcerative colitis identifies three new susceptibility loci, including the HNF4A region.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19526105 2008 Clinical significance of levels of molecular biological markers in zones of invasive front-line of colorectal cancer.
19416897 2009 Laminin-111 protein therapy prevents muscle disease in the mdx mouse model for Duchenne muscular dystrophy.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19147489 2009 The C-terminal region of laminin beta chains modulates the integrin binding affinities of laminins.
19122664 2009 Ulcerative colitis-risk loci on chromosomes 1p36 and 12q15 found by genome-wide association study.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18691630 2008 Expression of laminin beta1 in hippocampi of patients with intractable epilepsy.
18474427 2008 Immunohistochemical study of the extracellular matrix proteins laminin, fibronectin and type IV collagen in secretory meningiomas.
18450753 2008 Redundant mechanism of platelet adhesion to laminin and collagen under flow: involvement of von Willebrand factor and glycoprotein Ib-IX-V.
18162078 2008 Ethanol increases fetal human neurosphere size and alters adhesion molecule gene expression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16289578 2006 Characterization of commercial laminin preparations from human placenta in comparison to recombinant laminins 2 (alpha2beta1gamma1), 8 (alpha4beta1gamma1), 10 (alpha5beta1gamma1).
16236823 2006 Laminin-10 and Lutheran blood group glycoproteins in adhesion of human endothelial cells.
16146715 2006 Changes in laminin isoforms associated with brain tumor invasion and angiogenesis.
15987446 2005 Overexpression of beta1-chain-containing laminins in capillary basement membranes of human breast cancer and its metastases.
15967115 2005 Membrane type 1 matrix metalloprotease cleaves laminin-10 and promotes prostate cancer cell migration.
15894315 2005 Laminins 2 (alpha2beta1gamma1, Lm-211) and 8 (alpha4beta1gamma1, Lm-411) are synthesized and secreted by tooth pulp fibroblasts and differentially promote neurite outgrowth from trigeminal ganglion sensory neurons.
15706419 2005 Genes associated with the genesis of leiomyoma of the uterus in a commonly deleted chromosomal region at 7q22.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474030 2004 Mouse acetylcholinesterase interacts in yeast with the extracellular matrix component laminin-1beta.
14557481 2003 Laminin isoforms in fetal and adult human adrenal cortex.
12853948 2003 The DNA sequence of human chromosome 7.
12743034 2003 Laminin-10 is crucial for hair morphogenesis.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12615822 2003 An association of IgG anti-laminin-1 autoantibodies with endometriosis in infertile patients.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11891225 2002 Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways.
11311202 2001 Amplification of extracellular matrix and oncogenes in tat-transfected human salivary gland cell lines with expression of laminin, fibronectin, collagens I, III, IV, c-myc and p53.
11096140 2000 Abnormal expression of glomerular basement membrane laminins in membranous glomerulonephritis.
11067943 2000 Monocytic cells synthesize, adhere to, and migrate on laminin-8 (alpha 4 beta 1 gamma 1).
11054877 2000 Integrins as receptors for laminins.
10964500 2000 Posttranslational modifications and beta/gamma chain associations of human laminin alpha1 and laminin alpha5 chains: purification of laminin-3 from placenta.
10842354 2000 Form and function: the laminin family of heterotrimers.
10801807 2000 Structural requirement of carboxyl-terminal globular domains of laminin alpha 3 chain for promotion of rapid cell adhesion and migration by laminin-5.
10671376 2000 Integrin binding specificity of laminin-10/11: laminin-10/11 are recognized by alpha 3 beta 1, alpha 6 beta 1 and alpha 6 beta 4 integrins.
10407855 1999 Decreased expression of laminin beta 1 in chromosome 21-linked Bethlem myopathy.
10225960 1999 Characterization and expression of the laminin gamma3 chain: a novel, non-basement membrane-associated, laminin chain.
9647658 1998 The laminin-nidogen complex is a ligand for a specific splice isoform of the transmembrane protein tyrosine phosphatase LAR.
9435560 1997 Adult human colonic subepithelial myofibroblasts express extracellular matrix proteins and cyclooxygenase-1 and -2.
9309712 1997 Expression of laminin chains in skin in merosin-deficient congenital muscular dystrophy.
9196901 1997 Early onset autosomal dominant myopathy with rigidity of the spine: a possible role for laminin beta 1?
9184849 1997 Changes in the distribution of integrins and their basement membrane ligands during development of human thyroid follicular epithelium.
7921537 1994 A new nomenclature for the laminins.
3661559 1987 Isolation of a cDNA clone for the human laminin-B1 chain and its gene localization.
3611077 1987 Human laminin B1 chain. A multidomain protein with gene (LAMB1) locus in the q22 region of chromosome 7.
3493487 1987 Sequence of the cDNA encoding the laminin B1 chain reveals a multidomain protein containing cysteine-rich repeats.
2704655 1989 Aortic root dilatation associated with partial trisomy 7(q31.2----qter).
2563160 1989 A Hpa I polymorphism in the human laminin B1 chain gene on 7q22.
2099832 1990 Distribution and isolation of four laminin variants; tissue restricted distribution of heterotrimers assembled from five different subunits.
1975589 1990 Structure of the human laminin B1 chain gene.
1864606 1991 Recurrent ctb(7)(q31.3) and possible laminin involvement in a neonatal cutis laxa with a Marfan phenotype.