Property Summary

NCBI Gene PubMed Count 83
PubMed Score 24.54
PubTator Score 47.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.400 2.0e-06
glioblastoma multiforme 1.200 1.6e-18
pancreatic ductal adenocarcinoma liver m... 1.096 2.4e-02
group 3 medulloblastoma 1.100 4.9e-02
ovarian cancer 1.200 5.6e-04

Protein-protein Interaction (12)

Gene RIF (47)

PMID Text
26235893 disruption of the LAMA5 gene dramatically reduced hPSC self-renewal and increased apoptosis without affecting the expression of pluripotency markers.
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24503541 Gal-1 decreased the expression of collagen genes COL3A1 and COL5A1 but increased the expression of fibronectin and laminin 5.
24036115 Lutheran (Lu), also known as basal cell adhesion molecule (B-CAM), competes with integrins for binding to laminin alpha5, a subunit of LM-511, a major component of basement membranes.
23715200 The laminin-5 staining pattern was significantly more often continuous in severe dysplasia/carcinoma-in-situ
22666383 mechanistic role of laminin-511 in tissue homeostasis
22099024 These results indicate specific laminin isoforms and integrins in maintenance of human embryonic stem cells pluripotency in feeder-dependent cultures.
21921666 PDGF-BB is not superior to laminin as a potential marker of advanced CP.
21858073 Data indicate that the function-blocking antibody against Lu/B-CAM should be useful for not only investigating cell adhesion to laminin alpha5 but also for developing drugs to inhibit sickle cell vaso-occlusion.
21461966 Polymorphisms in LN5 were associated with a reduced level of hemoglobin and neutropenia in non-small cell lung cancer.
21195710 Data suggest that the alpha5 laminins emerge as putative primary extracellular matrix mediators of melanoma invasion and metastasis via alpha3/alpha6beta1 and other integrin receptors.
21067603 Data provides support for a primary role of laminin-511 and integrin beta-1 promoting hair follicle epithelial downgrowth without affecting dermal primary cilia and Shh target gene induction.
20951195 LAMA5 rs659822 regulates anthropometric and metabolic traits in elderly people
20951195 Observational study of gene-disease association. (HuGE Navigator)
20819124 investigated the relation between epithelial-mesenchymal transition criteria and laminin-332 expression in a cell culture model of transforming growth factor beta-1 (TGFbeta1)/epithelial growth factor (EGF) long time co-stimulation.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20433883 Data from experiment with peptide fragments suggest laminin alpha5 (and laminin alpha4) may be part of host defense response and may protect tissues from invading pathogens.
20019771 Abnormal distribution of laminin alpha1 and laminin alpha5 in glomerular basement membrane is correlated with GBM thickening and splitting in human Alport's syndrome.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19752234 Alpha3- and alpha5-laminins, but not other laminin isoforms, mediate mast cell adhesion via alpha3beta1 integrin.
19615022 Cytoplasmic and basement membrane laminin is important in the pathogenesis and invasion of basal cell carcinoma.
18694491 results suggest an evolutionarily conserved role of a member of the laminin gene family in contributing to variation in weight and body composition
18635166 These results suggest that laminins containing alpha 5 serve as functional substrates regulating progression of hepatocellular carcinoma.
18523231 alpha5-laminin was the most adhesion- and migration-promoting isoform for human blood lymphocytes, followed by alpha3- (Lm-332) and alpha4- (Lm-411) laminins.
18496706 Concomitant changes take place in laminin- and collagen-binding receptors. Laminin-411 reduces adhesion to laminin-511 and fibronectin, suggesting that tumor cells could utilize laminin-411 in their invasive behavior
17888902 The results indicate that glioma cells secrete alpha2-, alpha4- and alpha5-laminins and that alpha3- and alpha5-laminins, selectively promote glioma cell migration and identify alpha3beta1 as the predominant integrin and laminin receptor in glioma cells.
16940506 in natural HPV infection, proliferating keratinocytes expressing alpha6 integrin at the site of epithelial wounding might be targeted by virions adsorbed transiently to LN5 secreted by migrating keratinocytes
16723698 laminin 5 and p16INK4A have roles in wound healing and senescence
16460839 Results describe the expression of laminin 5 by parental and c-Ha-ras-transformed HaCaT keratinocytes in organotypic cultures.
16339173 Data show that alpha6 and alpha3 integrin subunits interact with laminin 5 to increase expression of E-cadherin, and suggest that phosphoinositide 3-kinase (PI 3-kinase) activation plays a key role in this cross-talk.
16226104 An increase was noted in LAMA5 immunostaining in the dilated muscle of the ganglionic bowel upstream the distal aganglionic region in a group of Hirschprung disease patients.
15975931 Protein kinase A-dependent phosphorylation of Lutheran/basal cell adhesion molecule glycoprotein regulates cell adhesion to laminin alpha5
15967115 prostate cancer cells expressing high levels of MT1-MMP have increased invasive potential through their ability to degrade and invade Ln-10 barriers
15579904 alpha6beta4 can augment cell-cell adhesion and slow down haptotaxis over laminin-5
15302884 cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin
14691145 Autocrine LM-5 mediates anchorage-independent survival in breast tumors through ligation of a wild-type, but not a cytoplasmic tail-truncated alpha6beta4 integrin.
12817023 Incubation of mouse macrophages with human laminin alpha5 chain peptide results in marked increase in matrix metalloproteinase-9 mRNA and gelatinolytic activity; this peptide is chemotactic for mouse neutrophils and macrophages in vitro and in vivo.
12743034 Data suggest that laminin-10 (alpha5beta1gamma1) is required for hair follicle development and report the first use of exogenous protein to correct a cutaneous developmental defect.
12691260 Data suggest that this alphavbeta3 binding to alpha5-laminins is involved in the regulation of cellular responses to growth factors known to be involved in epithelial and endothelial development.
12682087 Our results elucidate a mechanism whereby mesangial cells organize the glomerular capillaries by adhering to the G domain of laminin alpha5 in the glomerular basement membrane.
12393739 Laminins with alpha1, alph4, and alpha5 chains are compared to determine laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells.
12382139 role for laminin-5 during human embryogenesis, for example, for epithelial cell development, beyond its involvement in hemidesmosome formation and cell adhesion.
12379663 LN6 and LN5 have distinct biological activities, but they may cooperatively support cell adhesion
12242717 LN5 has a role in the differentiation of the tracheal epithelium in human embryos
11891225 Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways (Laminin 10; separate entry for Laminin 11).
11311202 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
9597096 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution

AA Sequence

MAKRLCAGSALCVRGPRGPAPLLLVGLALLGAARAREEAGGGFSLHPPYFNLAEGARIAASATCGEEAPA      1 - 70
RGSPRPTEDLYCKLVGGPVAGGDPNQTIRGQYCDICTAANSNKAHPASNAIDGTERWWQSPPLSRGLEYN     71 - 140
EVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGRTYQPWQFFASSKRDCLERFGPQTLERITRD    141 - 210
DAAICTTEYSRIVPLENGEIVVSLVNGRPGAMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRD    211 - 280
PTVTRRYYYSIKDISIGGRCVCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATA    281 - 350
NSANECQSCNCYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPL    351 - 420
DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSNDTREQVLPAGQ    421 - 490
IVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGCQPCQCSSPGVADDRCDPDTGQC    491 - 560
RCRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCDEAGRCLCQPEFAGPHCDRCRPGYHGFPNCQ    561 - 630
ACTCDPRGALDQLCGAGGLCRCRPGYTGTACQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRP    631 - 700
RVTGLRCDTCVPGAYNFPYCEAGSCHPAGLAPVDPALPEAQVPCMCRAHVEGPSCDRCKPGFWGLSPSNP    701 - 770
EGCTRCSCDLRGTLGGVAECQPGTGQCFCKPHVCGQACASCKDGFFGLDQADYFGCRSCRCDIGGALGQS    771 - 840
CEPRTGVCRCRPNTQGPTCSEPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFENFSWRGYAQMA    841 - 910
PVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSATCANCTAQSQPVAFPPSTEPAFITV    911 - 980
PQRGFGEPFVLNPGTWALRVEAEGVLLDYVVLLPSAYYEAALLQLRVTEACTYRPSAQQSGDNCLLYTHL    981 - 1050
PLDGFPSAAGLEALCRQDNSLPRPCPTEQLSPSHPPLITCTGSDVDVQLQVAVPQPGRYALVVEYANEDA   1051 - 1120
RQEVGVAVHTPQRAPQQGLLSLHPCLYSTLCRGTARDTQDHLAVFHLDSEASVRLTAEQARFFLHGVTLV   1121 - 1190
PIEEFSPEFVEPRVSCISSHGAFGPNSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTHAQDLTPAMSP   1191 - 1260
AGPRPRPPTAVDPDAEPTLLREPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLINAGRVWQGHAN   1261 - 1330
ASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPKGRWLWLDYVLVVPENVYSFGYLREEPLDKSYDF   1331 - 1400
ISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGCHEVGATGPTCEPFGGQCPCHAHVIGRDCSR   1401 - 1470
CATGYWGFPNCRPCDCGARLCDELTGQCICPPRTIPPDCLLCQPQTFGCHPLVGCEECNCSGPGIQELTD   1471 - 1540
PTCDTDSGQCKCRPNVTGRRCDTCSPGFHGYPRCRPCDCHEAGTAPGVCDPLTGQCYCKENVQGPKCDQC   1541 - 1610
SLGTFSLDAANPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERQPGTEMLRADLRH   1611 - 1680
VPEAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPMESRPDVVLQGNQMSITFLEPA   1681 - 1750
YPTPGHVHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFSQISSAVFLRRVALEVASPAG   1751 - 1820
QGALASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGRCVPCQCHGHSDRCLPGSGVCVDCQHNTEGA   1821 - 1890
HCERCQAGFVSSRDDPSAPCVSCPCPLSVPSNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPL   1891 - 1960
VLGSSCQPCDCSGNGDPNLLFSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCTPCGT   1961 - 2030
EACDPHSGHCLCKAGVTGRRCDRCQEGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCR   2031 - 2100
ECAPGYWGLPEQGCRRCQCPGGRCDPHTGRCNCPPGLSGERCDTCSQQHQVPVPGGPVGHSIHCEVCDHC   2101 - 2170
VVLLLDDLERAGALLPAIHEQLRGINASSMAWARLHRLNASIADLQSQLRSPLGPRHETAQQLEVLEQQS   2171 - 2240
TSLGQDARRLGGQAVGTRDQASQLLAGTEATLGHAKTLLAAIRAVDRTLSELMSQTGHLGLANASAPSGE   2241 - 2310
QLLRTLAEVERLLWEMRARDLGAPQAAAEAELAAAQRLLARVQEQLSSLWEENQALATQTRDRLAQHEAG   2311 - 2380
LMDLREALNRAVDATREAQELNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQA   2381 - 2450
KEELERLAASLDGARTPLLQRMQTFSPAGSKLRLVEAAEAHAQQLGQLALNLSSIILDVNQDRLTQRAIE   2451 - 2520
ASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQQRLGLVWAAL   2521 - 2590
QGARTQLRDVRAKKDQLEAHIQAAQAMLAMDTDETSKKIAHAKAVAAEAQDTATRVQSQLQAMQENVERW   2591 - 2660
QGQYEGLRGQDLGQAVLDAGHSVSTLEKTLPQLLAKLSILENRGVHNASLALSASIGRVRELIAQARGAA   2661 - 2730
SKVKVPMKFNGRSGVQLRTPRDLADLAAYTALKFYLQGPEPEPGQGTEDRFVMYMGSRQATGDYMGVSLR   2731 - 2800
DKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLR   2801 - 2870
PDDFVFYVGGYPSTFTPPPLLRFPGYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWL   2871 - 2940
TDGSYLDGTGFARISFDSQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVQEGSLVLLYDFGAGLKK   2941 - 3010
AVPLQPPPPLTSASKAIQVFLLGGSRKRVLVRVERATVYSVEQDNDLELADAYYLGGVPPDQLPPSLRRL   3011 - 3080
FPTGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLLVGRAMTFHGHGFLRLALSNVAPLTGNVYSG   3081 - 3150
FGFHSAQDSALLYYRASPDGLCQVSLQQGRVSLQLLRTEVKTQAGFADGAPHYVAFYSNATGVWLYVDDQ   3151 - 3220
LQQMKPHRGPPPELQPQPEGPPRLLLGGLPESGTIYNFSGCISNVFVQRLLGPQRVFDLQQNLGSVNVST   3221 - 3290
GCAPALQAQTPGLGPRGLQATARKASRRSRQPARHPACMLPPHLRTTRDSYQFGGSLSSHLEFVGILARH   3291 - 3360
RNWPSLSMHVLPRSSRGLLLFTARLRPGSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRSRPGRWHKVSV   3361 - 3430
RWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRP   3431 - 3500
LGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYL   3501 - 3570
QLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAP   3571 - 3640
APLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGCPAA                  3641 - 3695
//

Text Mined References (88)

PMID Year Title
26235893 2015 ?-5 Laminin Synthesized by Human Pluripotent Stem Cells Promotes Self-Renewal.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24503541 2014 Galectin-1 stimulates motility of human umbilical cord blood-derived mesenchymal stem cells by downregulation of smad2/3-dependent collagen 3/5 and upregulation of NF-?B-dependent fibronectin/laminin 5 expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24036115 2013 The lutheran/basal cell adhesion molecule promotes tumor cell migration by modulating integrin-mediated cell attachment to laminin-511 protein.
23715200 2013 The expression of laminin-5 in severe dysplasia/carcinoma in situ and early invasive squamous cell carcinoma: an immunohistochemical study.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264881 2012 Common variants in the LAMA5 gene associate with fasting plasma glucose and serum triglyceride levels in a cohort of pre-and early pubertal children.
22666383 2012 Abnormal Wnt and PI3Kinase signaling in the malformed intestine of lama5 deficient mice.
22099024 2012 Laminin-511 expression is associated with the functionality of feeder cells in human embryonic stem cell culture.
21921666 2011 Coordinated increase in serum platelet-derived growth factor-BB and transforming growth factor-?1 in patients with chronic pancreatitis.
21858073 2011 An antibody to the lutheran glycoprotein (Lu) recognizing the LU4 blood type variant inhibits cell adhesion to laminin ?5.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21461966 2012 Posttreatment plasma VEGF levels may be associated with the overall survival of patients with advanced non-small cell lung cancer treated with bevacizumab plus chemotherapy.
21269460 2011 Initial characterization of the human central proteome.
21195710 2011 Melanoma cells produce multiple laminin isoforms and strongly migrate on ?5 laminin(s) via several integrin receptors.
21067603 2010 Laminin-511 and integrin beta-1 in hair follicle development and basal cell carcinoma formation.
20972440 2010 Meta-analysis of three genome-wide association studies identifies susceptibility loci for colorectal cancer at 1q41, 3q26.2, 12q13.13 and 20q13.33.
20951195 2011 Association of a common LAMA5 variant with anthropometric and metabolic traits in an Italian cohort of healthy elderly subjects.
20819124 2011 EGF/TGF?1 co-stimulation of oral squamous cell carcinoma cells causes an epithelial-mesenchymal transition cell phenotype expressing laminin 332.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20433883 2010 Peptides derived from the human laminin alpha4 and alpha5 chains exhibit antimicrobial activity.
20019771 2009 [Correlation between ultrastructural changes of glomerular basement membrane and abnormal distribution of laminins in patients with Alport's syndrome].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19752234 2009 Human mast cells adhere to and migrate on epithelial and vascular basement membrane laminins LM-332 and LM-511 via alpha3beta1 integrin.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615022 2010 An immunohistochemical study of laminin in basal cell carcinoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18694491 2008 Genetic variation in a member of the laminin gene family affects variation in body composition in Drosophila and humans.
18635166 2008 Laminin alpha 5 mediates ectopic adhesion of hepatocellular carcinoma through integrins and/or Lutheran/basal cell adhesion molecule.
18523231 2008 Laminin isoforms of lymph nodes and predominant role of alpha5-laminin(s) in adhesion and migration of blood lymphocytes.
18496706 2008 Epithelial-mesenchymal transition downregulates laminin alpha5 chain and upregulates laminin alpha4 chain in oral squamous carcinoma cells.
17888902 2007 Laminin isoforms and their integrin receptors in glioma cell migration and invasiveness: Evidence for a role of alpha5-laminin(s) and alpha3beta1 integrin.
16940506 2006 Keratinocyte-secreted laminin 5 can function as a transient receptor for human papillomaviruses by binding virions and transferring them to adjacent cells.
16723698 2006 A keratinocyte hypermotility/growth-arrest response involving laminin 5 and p16INK4A activated in wound healing and senescence.
16581764 2006 Multiple functions of the integrin alpha6beta4 in epidermal homeostasis and tumorigenesis.
16460839 2006 Expression of laminin 5 by parental and c-Ha-ras-transformed HaCaT keratinocytes in organotypic cultures.
16339173 2006 Laminin-5-integrin interaction signals through PI 3-kinase and Rac1b to promote assembly of adherens junctions in HT-29 cells.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16236823 2006 Laminin-10 and Lutheran blood group glycoproteins in adhesion of human endothelial cells.
16226104 2005 The expression pattern of laminin isoforms in Hirschsprung disease reveals a distal peripheral nerve differentiation.
15975931 2005 Protein kinase A-dependent phosphorylation of Lutheran/basal cell adhesion molecule glycoprotein regulates cell adhesion to laminin alpha5.
15967115 2005 Membrane type 1 matrix metalloprotease cleaves laminin-10 and promotes prostate cancer cell migration.
15579904 2005 Integrin alpha6beta4-erbB2 complex inhibits haptotaxis by up-regulating E-cadherin cell-cell junctions in keratinocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302884 2004 The cAMP-Epac-Rap1 pathway regulates cell spreading and cell adhesion to laminin-5 through the alpha3beta1 integrin but not the alpha6beta4 integrin.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14691145 2003 Autocrine laminin-5 ligates alpha6beta4 integrin and activates RAC and NFkappaB to mediate anchorage-independent survival of mammary tumors.
14557481 2003 Laminin isoforms in fetal and adult human adrenal cortex.
12817023 2003 A site on laminin alpha 5, AQARSAASKVKVSMKF, induces inflammatory cell production of matrix metalloproteinase-9 and chemotaxis.
12743034 2003 Laminin-10 is crucial for hair morphogenesis.
12691260 2003 Integrin alphavbeta3 binding to human alpha5-laminins facilitates FGF-2- and VEGF-induced proliferation of human ECV304 carcinoma cells.
12682087 2003 Mesangial cells organize the glomerular capillaries by adhering to the G domain of laminin alpha5 in the glomerular basement membrane.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393739 2003 Laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells.
12382139 2002 In situ-RT-PCR and immunohistochemistry for the localisation of the mRNA of the alpha 3 chain of laminin and laminin-5 during human organogenesis.
12379663 2002 Laminin-6 is activated by proteolytic processing and regulates cellular adhesion and migration differently from laminin-5.
12366691 2002 Laminin 10/11: an alternative adhesive ligand for epidermal keratinocytes with a functional role in promoting proliferation and migration.
12244066 2002 Identification of the binding site for the Lutheran blood group glycoprotein on laminin alpha 5 through expression of chimeric laminin chains in vivo.
12242717 2002 Distribution of laminin 5, integrin receptors, and branching morphogenesis during human fetal lung development.
11985661 2002 Developmentally regulated interactions of human thymocytes with different laminin isoforms.
11964076 2002 Regulation of melanoma cell migration and invasion by laminin-5 and alpha3beta1 integrin (VLA-3).
11891225 2002 Laminin-10/11 and fibronectin differentially prevent apoptosis induced by serum removal via phosphatidylinositol 3-kinase/Akt- and MEK1/ERK-dependent pathways.
11821406 2002 Recombinant human laminin-10 (alpha5beta1gamma1). Production, purification, and migration-promoting activity on vascular endothelial cells.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11572484 2001 Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins.
11352943 2001 The short arm of the laminin gamma2 chain plays a pivotal role in the incorporation of laminin 5 into the extracellular matrix and in cell adhesion.
11311202 2001 Amplification of extracellular matrix and oncogenes in tat-transfected human salivary gland cell lines with expression of laminin, fibronectin, collagens I, III, IV, c-myc and p53.
11159210 2001 Overexpression of matrix metalloproteinase-10 and matrix metalloproteinase-3 in human diabetic corneas: a possible mechanism of basement membrane and integrin alterations.
11133776 2001 Lutheran blood group glycoprotein and its newly characterized mouse homologue specifically bind alpha5 chain-containing human laminin with high affinity.
11104726 2000 Expression patterns of laminin alpha1 and alpha5 in human lung during development.
10964957 2000 Laminin expression in adult and developing retinae: evidence of two novel CNS laminins.
10964500 2000 Posttranslational modifications and beta/gamma chain associations of human laminin alpha1 and laminin alpha5 chains: purification of laminin-3 from placenta.
10671376 2000 Integrin binding specificity of laminin-10/11: laminin-10/11 are recognized by alpha 3 beta 1, alpha 6 beta 1 and alpha 6 beta 4 integrins.
10620696 2000 Heterologously overexpressed, affinity-purified human meprin alpha is functionally active and cleaves components of the basement membrane in vitro.
10617638 2000 The synaptic vesicle protein SV2 is complexed with an alpha5-containing laminin on the nerve terminal surface.
10207021 1999 Adhesion of cultured bovine aortic endothelial cells to laminin-1 mediated by dystroglycan.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9353324 1997 Presence of laminin alpha5 chain and lack of laminin alpha1 chain during human muscle development and in muscular dystrophies.
9271224 1997 Tissue-specific expression of the human laminin alpha5-chain, and mapping of the gene to human chromosome 20q13.2-13.3 and to distal mouse chromosome 2 near the locus for the ragged (Ra) mutation.
9006922 1997 Fibulin-2 binds to the short arms of laminin-5 and laminin-1 via conserved amino acid sequences.
7499364 1995 Molecular cloning of a novel laminin chain, alpha 5, and widespread expression in adult mouse tissues.