Property Summary

NCBI Gene PubMed Count 46
PubMed Score 12.92
PubTator Score 42.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 51 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 4.0
Disease Target Count
Cardiomyopathy, dilated 1JJ 1

Expression

  Differential Expression (38)

Disease log2 FC p
urothelial carcinoma 2.400 1.1e-03
malignant mesothelioma -8.700 2.3e-10
psoriasis -1.200 2.3e-04
astrocytoma 1.100 1.0e-08
glioblastoma 2.200 2.3e-08
oligodendroglioma 1.100 1.1e-05
osteosarcoma 2.918 1.2e-06
posterior fossa group A ependymoma 1.500 5.7e-07
cystic fibrosis 4.460 1.8e-07
atypical teratoid/rhabdoid tumor 1.300 5.6e-03
Duchenne muscular dystrophy 1.666 3.3e-09
autosomal dominant Emery-Dreifuss muscul... 1.370 7.2e-03
Becker muscular dystrophy 1.120 2.9e-03
juvenile dermatomyositis 1.588 2.2e-11
primary pancreatic ductal adenocarcinoma 2.266 1.6e-03
intraductal papillary-mucinous adenoma (... -1.400 2.5e-02
X-linked cerebral adrenoleukodystrophy -1.200 2.0e-02
lung cancer -3.800 4.9e-05
breast carcinoma -1.800 1.1e-04
fibroadenoma -1.900 6.9e-03
interstitial cystitis 1.400 2.8e-03
lung adenocarcinoma -1.510 5.4e-06
pediatric high grade glioma 1.900 4.5e-07
pilocytic astrocytoma 2.800 2.9e-13
subependymal giant cell astrocytoma 1.969 2.6e-03
nasopharyngeal carcinoma 1.300 9.2e-04
lung carcinoma -1.200 1.3e-06
non-small cell lung carcinoma -1.100 4.7e-14
Breast cancer 1.100 1.2e-03
gastric carcinoma 1.700 5.2e-03
ductal carcinoma in situ -1.900 7.1e-04
invasive ductal carcinoma -2.400 3.7e-04
ulcerative colitis 1.700 9.6e-04
ovarian cancer -5.500 4.9e-11
Gaucher disease type 1 -1.200 2.3e-02
pancreatic cancer 1.700 1.6e-03
dermatomyositis 1.900 7.8e-03
head and neck cancer -1.500 2.1e-02

 IMPC Phenotype (1)

Protein-protein Interaction (10)

Gene RIF (25)

PMID Text
26295200 LAMA4-integrin signalling affects chondrocyte morphology and gene expression, contributing to cluster formation in osteoarthritic chondrocytes.
26059342 LAMA4 expression is lowered in preeclamptic placentas and promotes trophoblast cell invasion, migration, and angiogenesis. hypoxia-reoxygenation decreases LAMA4 expression and decouple the relationship between LAMA4 expression and p38 and ERK activation.
25676580 Oxidative stress plays a vital role in controlling expression of LAMA4 through MAPK signaling pathways, which suggests a possible pathological mechanism of pre-eclampsia.
24951930 Laminins 411 and 421 differentially promote tumor cell migration via alpha6beta1 integrin and MCAM (CD146).
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24681327 These results indicate that mAbs to the laminin a4 globular domain are able to inhibit tumor cell adhesion and migration on laminins 411 and 421, and that alpha6beta1 integrin and MCAM bind a4-laminins at very close sites on the globular domain
20485444 Observational study of gene-disease association. (HuGE Navigator)
20433883 Data from experiment with peptide fragments suggest laminin alpha4 (and laminin alpha5) may be part of host defense response and may protect tissues from invading pathogens.
19469865 LAMC2, LAMA4, ITGB1, ITGB3, RSPA and MMP2) are overexpressed in angiotropic melanoma cells vs. non-angiotropic melanoma cells from the same tumor
19048114 LM alpha4 and beta2 have roles in in vitro migration and in vivo tumorigenicity of prostate cancer cells
18978678 Observational study of gene-disease association. (HuGE Navigator)
18496706 Concomitant changes take place in laminin- and collagen-binding receptors. Laminin-411 reduces adhesion to laminin-511 and fibronectin, suggesting that tumor cells could utilize laminin-411 in their invasive behavior
18084776 LAMA4 is specifically up-regulated on both mRNA and protein levels in hepatocelluar carcinoma; potential role in hepatocarcinogenesis and tumor progression.
17646580 2 novel mutations (2828C>T [Pro943Leu] & 3217C>T [Arg1073X]) in the integrin-interacting domain of the LAMA4 gene reduce its integrin binding, & cause endothelial cell loss and heart failure.
17533363 alpha4 chain Lms have a de-adhesive function and could thus play a role in detachment, migration and invasion of renal carcinoma cells in vivo.
16824487 This suggests that G(1121-1139) peptide-containing proteins may perform their biological functions by interacting with alphavbeta3 integrin.
16146715 laminin isoform changes are associated with brain tumor invasion and angiogenesis [review]
15915502 Downregulation of laminin alpha4 chain expression inhibits glioma invasion
15086543 laminin alpha4 LG4 module may play an important role in cell adhesion and/or vessel wall formation in the skin by interacting with syndecan-2 and/or -4.
14980521 The alpha4 laminin subunit regulates vascular endothelium cell survival.
12454288 The G domain of laminin alpha4 chain is a specific, high affinity ligand for alphavbeta3 & alpha3beta1 integrin heterodimers. These integrins, with alpha6beta1, cooperatively mediate endothelial cell-alpha4 laminin interaction & blood vessel development.
12445830 Data report the identification of a splice variant of the human laminin alpha4 subunit transcript containing 21 extra nucleotides.
12393739 Laminins with alpha1, alpha4, and alpha5 chains are compared to determine laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells.
11311202 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
9597096 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution

AA Sequence

MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEKCNAG      1 - 70
FFHTLSGECVPCDCNGNSNECLDGSGYCVHCQRNTTGEHCEKCLDGYIGDSIRGAPQFCQPCPCPLPHLA     71 - 140
NFAESCYRKNGAVRCICNENYAGPNCERCAPGYYGNPLLIGSTCKKCDCSGNSDPNLIFEDCDEVTGQCR    141 - 210
NCLRNTTGFKCERCAPGYYGDARIAKNCAVCNCGGGPCDSVTGECLEEGFEPPTGMDCPTISCDKCVWDL    211 - 280
TDALRLAALSIEEGKSGVLSVSSGAAAHRHVNEINATIYLLKTKLSERENQYALRKIQINNAENTMKSLL    281 - 350
SDVEELVEKENQASRKGQLVQKESMDTINHASQLVEQAHDMRDKIQEINNKMLYYGEEHELSPKEISEKL    351 - 420
VLAQKMLEEIRSRQPFFTQRELVDEEADEAYELLSQAESWQRLHNETRTLFPVVLEQLDDYNAKLSDLQE    421 - 490
ALDQALNYVRDAEDMNRATAARQRDHEKQQERVREQMEVVNMSLSTSADSLTTPRLTLSELDDIIKNASG    491 - 560
IYAEIDGAKSELQVKLSNLSNLSHDLVQEAIDHAQDLQQEANELSRKLHSSDMNGLVQKALDASNVYENI    561 - 630
VNYVSEANETAEFALNTTDRIYDAVSGIDTQIIYHKDESENLLNQARELQAKAESSSDEAVADTSRRVGG    631 - 700
ALARKSALKTRLSDAVKQLQAAERGDAQQRLGQSRLITEEANRTTMEVQQATAPMANNLTNWSQNLQHFD    701 - 770
SSAYNTAVNSARDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMMFDG    771 - 840
QSAVEVHSRTSMDDLKAFTSLSLYMKPPVKRPELTETADQFILYLGSKNAKKEYMGLAIKNDNLVYVYNL    841 - 910
GTKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTAEEKFIKKGEFSGDDSLLDLDPEDT    911 - 980
VFYVGGVPSNFKLPTSLNLPGFVGCLELATLNNDVISLYNFKHIYNMDPSTSVPCARDKLAFTQSRAASY    981 - 1050
FFDGSGYAVVRDITRRGKFGQVTRFDIEVRTPADNGLILLMVNGSMFFRLEMRNGYLHVFYDFGFSGGPV   1051 - 1120
HLEDTLKKAQINDAKYHEISIIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRALRA   1121 - 1190
HLPLDINFRGCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASIQKISFFDGFEGG   1191 - 1260
FNFRTLQPNGLLFYYASGSDVFSISLDNGTVIMDVKGIKVQSVDKQYNDGLSHFVISSVSPTRYELIVDK   1261 - 1330
SRVGSKNPTKGKIEQTQASEKKFYFGGSPISAQYANFTGCISNAYFTRVDRDVEVEDFQRYTEKVHTSLY   1331 - 1400
ECPIESSPLFLLHKKGKNLSKPKASQNKKGGKSKDAPSWDPVALKLPERNTPRNSHCHLSNSPRAIEHAY   1401 - 1470
QYGGTANSRQEFEHLKGDFGAKSQFSIRLRTRSSHGMIFYVSDQEENDFMTLFLAHGRLVYMFNVGHKKL   1471 - 1540
KIRSQEKYNDGLWHDVIFIRERSSGRLVIDGLRVLEESLPPTEATWKIKGPIYLGGVAPGKAVKNVQINS   1541 - 1610
IYSFSGCLSNLQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEVRPRS   1611 - 1680
SSGTLVHGHSVNGEYLNVHMKNGQVIVKVNNGIRDFSTSVTPKQSLCDGRWHRITVIRDSNVVQLDVDSE   1681 - 1750
VNHVVGPLNPKPIDHREPVFVGGVPESLLTPRLAPSKPFTGCIRHFVIDGHPVSFSKAALVSGAVSINSC   1751 - 1820
PAA                                                                      1821 - 1823
//

Text Mined References (48)

PMID Year Title
26295200 2016 Effect of Laminin-A4 inhibition on cluster formation of human osteoarthritic chondrocytes.
26059342 2015 Laminin ?4 (LAMA4) expression promotes trophoblast cell invasion, migration, and angiogenesis, and is lowered in preeclamptic placentas.
25676580 2015 The Role of Laminin ?4 in Human Umbilical Vein Endothelial Cells and Pathological Mechanism of Preeclampsia.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24951930 2014 Laminins 411 and 421 differentially promote tumor cell migration via ?6?1 integrin and MCAM (CD146).
24681327 2014 Monoclonal antibodies to human laminin ?4 chain globular domain inhibit tumor cell adhesion and migration on laminins 411 and 421, and binding of ?6?1 integrin and MCAM to ?4-laminins.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20433883 2010 Peptides derived from the human laminin alpha4 and alpha5 chains exhibit antimicrobial activity.
19469865 2009 Overexpression of malignancy-associated laminins and laminin receptors by angiotropic human melanoma cells in a chick chorioallantoic membrane model.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19048114 2008 Senescence-induced alterations of laminin chain expression modulate tumorigenicity of prostate cancer cells.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18496706 2008 Epithelial-mesenchymal transition downregulates laminin alpha5 chain and upregulates laminin alpha4 chain in oral squamous carcinoma cells.
18084776 2008 LAMA4, highly expressed in human hepatocellular carcinoma from Chinese patients, is a novel marker of tumor invasion and metastasis.
17646580 2007 Laminin-alpha4 and integrin-linked kinase mutations cause human cardiomyopathy via simultaneous defects in cardiomyocytes and endothelial cells.
17533363 2007 Alpha4 chain laminins are widely expressed in renal cell carcinomas and have a de-adhesive function.
16824487 2006 Identification of an active site on the laminin alpha4 chain globular domain that binds to alphavbeta3 integrin and promotes angiogenesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16146715 2006 Changes in laminin isoforms associated with brain tumor invasion and angiogenesis.
15915502 2005 Downregulation of laminin alpha4 chain expression inhibits glioma invasion in vitro and in vivo.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15086543 2004 Localization of the laminin alpha4 chain in the skin and identification of a heparin-dependent cell adhesion site within the laminin alpha4 chain C-terminal LG4 module.
14980521 2004 The alpha4 laminin subunit regulates endothelial cell survival.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14557481 2003 Laminin isoforms in fetal and adult human adrenal cortex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454288 2002 Complex interactions between the laminin alpha 4 subunit and integrins regulate endothelial cell behavior in vitro and angiogenesis in vivo.
12445830 2002 Identification and recombinant production of human laminin alpha4 subunit splice variants.
12393739 2003 Laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells.
12133914 2002 Localization of laminin alpha4-chain in developing and adult human tissues.
11311202 2001 Amplification of extracellular matrix and oncogenes in tat-transfected human salivary gland cell lines with expression of laminin, fibronectin, collagens I, III, IV, c-myc and p53.
11102753 2000 Differential expression of laminin alpha chains during proliferative and differentiation stages in a model for skin morphogenesis.
10934193 2000 Structural and functional analysis of the recombinant G domain of the laminin alpha4 chain and its proteolytic processing in tissues.
9310354 1997 The structural organisation of LAMA4, the gene encoding laminin alpha4.
9271224 1997 Tissue-specific expression of the human laminin alpha5-chain, and mapping of the gene to human chromosome 20q13.2-13.3 and to distal mouse chromosome 2 near the locus for the ragged (Ra) mutation.
9060828 1997 HMGI(Y) activation by chromosome 6p21 rearrangements in multilineage mesenchymal cells from pulmonary hamartoma.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8706685 1996 The complete cDNA sequence of laminin alpha 4 and its relationship to the other human laminin alpha chains.
8077230 1994 Cloning of the LamA3 gene encoding the alpha 3 chain of the adhesive ligand epiligrin. Expression in wound repair.
7959779 1994 Localization of the gene (LAMA4) to chromosome 6q21 and isolation of a partial cDNA encoding a variant laminin A chain.
7921537 1994 A new nomenclature for the laminins.
7781776 1995 Primary structure and expression of a novel human laminin alpha 4 chain.