Property Summary

NCBI Gene PubMed Count 93
PubMed Score 329.99
PubTator Score 85.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Amyotrophic Lateral Sclerosis 432 0.0 1.0
Disease Target Count Z-score Confidence
Junctional epidermolysis bullosa 9 0.0 5.0
Disease Target Count Z-score Confidence
Epidermolysis bullosa 21 5.028 2.5

Expression

Gene RIF (56)

PMID Text
25443231 LAMNA variants have been identified in atrial fibrillation cohort studies, demonstrating abnormalities in cardiac excitation - supra ventricular tachycardia and atrial fibrillation.
25363238 We established the LAMA3 gene as novel potential susceptibility gene for atopic dermatitis.
25188360 Loss of the normal basement membrane organization of alpha3 laminin observed in fibrotic regions from the lungs of patients with pulmonary fibrosis contributes to their disease progression.
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24675808 Two of the six genes (LAMA3 and DST) validated by quantitative RT-PCR for tumor-specific alternative splicing events
23907728 High LAMA3 expression is associated with gastric cancer.
23869449 Results describe a new pedigree identifying a novel mutation of LAMA3 in LOC syndrome
22963541 A male patient with Herlitz junctional epidermolysis bullosa with a novel homozygosity for insertion LAMA3 Premature Termination Codon mutation is described. Both parents and his sibling were shown to be heterozygous carriers.
22673183 invasive breast cancer cells confer an anoikis-resistant phenotype on myofibroblasts during tissue remodeling by inducing laminin-332 upregulation and integrin beta4 neoexpression
22563463 Data show laminin-332 (alpha3ss3gamma2)(Lm332) matrix supported adhesion of keratinocytes much more strongly and stably than purified Lm332.
22434185 Letter/Case Report: report novel LAMA3 mutations leading to enamel defects in epidermolysis bullosa.
22351752 the LAMA3 LG45 domain may trigger different signals toward keratinocytes depending on its interaction with syndecan-1 or -4.
21940345 Expression of a3, beta3 and beta2 cannot predict the prognosis. However, high expression of beta2 mRNA in HCC/non-cancerous liver correlated significantly with the absence of complete encapsulation, which is an important tumor invasiveness factor.
21276136 results suggest that Lm3B11/3B21 may be required for normal mature vessels and interfere with tumor angiogenesis
21034821 Cell surface COL17 can interact with laminin 332 and, together, participate in the adherence of a cell to the extracellular matrix.
20372818 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
20036365 SEMA3F, CLEC16A, LAMA3, and PCSK2 variants have roles in myocardial infarction in Japanese individuals
19945619 the alpha3 subunit of laminins-332, -321, and -311 plays an important role in mediating epidermal-dermal integrity and is essential for the skin to withstand mechanical stresses
19940114 Bisecting GlcNAc residues on laminin-332 down-regulate galectin-3-dependent keratinocyte motility.
19936049 a hypoxia related splice variant of LAMA3 may have a role in progression of head and neck cancers
19851296 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19773554 immunofluorescence analyses revealed a basement membrane staining in epithelial tissue for LaNt alpha3 and LaNt alpha3 localized along the substratum-associated surface of cultured keratinocytes.
19752234 Alpha3- and alpha5-laminins, but not other laminin isoforms, mediate mast cell adhesion via alpha3beta1 integrin.
19724895 Observational study of gene-disease association. (HuGE Navigator)
18664273 Smad4 mediates transcriptional regulation through three mechanisms: Smad4 binding to a functional SBE site in the LAMA3 promoter, Smad4 binding to AP1 (and Sp1) sites via interaction with AP1 family, and Smad4 impact on transcription of AP1 factors
18603785 the alpha3 chain can assemble with only beta3-gamma2 heterodimer to form a heterotrimer via disulfide bonds
17825249 These results suggest that Crk is required for early attachment to laminin, cell motility, and growth of glioblastoma cell line KMG4.
17482449 LM-332 is a crucial motility-promoting factor for B-CLL lymphocytes and is a potential constituent favoring the dissemination of B-CLL lymphocytes through vascular basement membranes and possibly lymph node compartments.
17466943 These results suggest a new possible approach to repairing SCI and, in general, a model which will be useful for other multidisciplinary procedures for complex neurological situations.
17137774 Laminin-5 alone stimulates global changes in gene/protein expression in mesenchymal stem cells that lead to commitment of these cells to the osteogenic phenotype, and this correlates with extracellular matrix production.
17071854 Laminin-5 may contribute to the development of bone tissues by promoting the proliferation and by suppressing the chondrogenic differentiation of MSCs.
17000025 The major contributions of laminin-5 to the resistance of the epidermis against frictional stress but also for basement membrane regeneration and repair of damaged skin are reflected by the phenotype of Herlitz junctional epidermolysis bullosa.
16870608 Ln-5 is an important regulator of ADPKD cell proliferation and cystogenesis; Ln-5 gamma(2) chain and Ln-5-alpha(6)beta(4) integrin interaction both contribute to these phenotypic changes
16537560 tumor cell migration on laminin-5 is inhibited by HYD1, a biologically active integrin-targeting peptide
16297184 The hinge region between subdomains G3 and G4 of laminin alpha 3 carries the proteolytic cleavage sites but proteolytic processing plays no role in kerocyte migration.
16219677 Suppression of laminin-5 alpha 3-chain expression in human mammary epithelial cells results in loss of reconstituted extracellular matrix-mediated growth control and apoptosis.
16179086 The uncoordinated production of chains of ln-5 in allergic asthma could have a bearing on the poor epithelial cell anchorage in these patients.
15854126 the absolute mRNA levels generated from the laminin 5 genes do not determine the translated protein levels of the laminin 5 chains in keratinocytes; the expression of the laminin 5 genes may be controlled by common regulation mechanisms
15695818 the LG4-5 domain synergistically enhances integrin signaling as it is released from the precursor LN5
15373767 Premature termination codon mutations in both alleles of LAMB3 or LAMC2 genes were found in nine of the 11 H junctional epidermolysis bullosa patients
15316072 The G4/5 domain in the alpha3 chain facilitates deposition of precursor laminin 5 into the PBM in epidermal wounds
15149852 co-cultures of epithelial cells and fibroblasts were studied to analyse the processing of laminin 5 alpha3, beta3, and gamma2 chains
15044476 Characterization of laminin 5B and NH2-terminal proteolytic fragment of its alpha3B chain
14695139 LAMA3 promoter methylation is associated with increased breast tumor stage and tumor size
14612440 proteolytic processing of laminin-5 influences its interaction with alpha3beta1 integrin
12947106 results demonstrate that the laminin alpha3 LG4/5 modules within unprocessed laminin-5 permit its cell binding activity through heparan and chondroitin sulfate chains of syndecan-1
12943669 a missense mutation in the adhesion G domain of laminin-5 causes mild junctional epidermolysis bullosa
12826666 laminin alpha 3 LG4 module may play an important role in tissue remodeling by inducing MMP-1 expression during wound healing
12532327 These results suggest that the G3 domain of laminin 5 alpha 3 contains two distinct regions that differently regulate cell adhesion and migration.
12382139 In all developing organs investigated, the mRNA of the alpha3 chain of laminin is strictly of epithelial origin and the corresponding protein localised in the underlying basement membrane zones
12196012 Neurite outgrowth promoting sites have been identified on the laminin alpha 3 chain LG4 module.
11775027 Characterization of morphological and cytoskeletal changes in MCF10A breast epithelial cells plated on laminin-5: comparison with breast cancer cell line MCF7.
11311202 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
9597096 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution

AA Sequence

MAAAARPRGRALGPVLPPTPLLLLVLRVLPACGATARDPGAAAGLSLHPTYFNLAEAARIWATATCGERG      1 - 70
PGEGRPQPELYCKLVGGPTAPGSGHTIQGQFCDYCNSEDPRKAHPVTNAIDGSERWWQSPPLSSGTQYNR     71 - 140
VNLTLDLGQLFHVAYILIKFANSPRPDLWVLERSVDFGSTYSPWQYFAHSKVDCLKEFGREANMAVTRDD    141 - 210
DVLCVTEYSRIVPLENGEVVVSLINGRPGAKNFTFSHTLREFTKATNIRLRFLRTNTLLGHLISKAQRDP    211 - 280
TVTRRYYYSIKDISIGGQCVCNGHAEVCNINNPEKLFRCECQHHTCGETCDRCCTGYNQRRWRPAAWEQS    281 - 350
HECEACNCHGHASNCYYDPDVERQQASLNTQGIYAGGGVCINCQHNTAGVNCEQCAKGYYRPYGVPVDAP    351 - 420
DGCIPCSCDPEHADGCEQGSGRCHCKPNFHGDNCEKCAIGYYNFPFCLRIPIFPVSTPSSEDPVAGDIKG    421 - 490
CDCNLEGVLPEICDAHGRCLCRPGVEGPRCDTCRSGFYSFPICQACWCSALGSYQMPCSSVTGQCECRPG    491 - 560
VTGQRCDRCLSGAYDFPHCQGSSSACDPAGTINSNLGYCQCKLHVEGPTCSRCKLLYWNLDKENPSGCSE    561 - 630
CKCHKAGTVSGTGECRQGDGDCHCKSHVGGDSCDTCEDGYFALEKSNYFGCQGCQCDIGGALSSMCSGPS    631 - 700
GVCQCREHVVGKVCQRPENNYYFPDLHHMKYEIEDGSTPNGRDLRFGFDPLAFPEFSWRGYAQMTSVQND    701 - 770
VRITLNVGKSSGSLFRVILRYVNPGTEAVSGHITIYPSWGAAQSKEIIFLPSKEPAFVTVPGNGFADPFS    771 - 840
ITPGIWVACIKAEGVLLDYLVLLPRDYYEASVLQLPVTEPCAYAGPPQENCLLYQHLPVTRFPCTLACEA    841 - 910
RHFLLDGEPRPVAVRQPTPAHPVMVDLSGREVELHLRLRIPQVGHYVVVVEYSTEAAQLFVVDVNVKSSG    911 - 980
SVLAGQVNIYSCNYSVLCRSAVIDHMSRIAMYELLADADIQLKGHMARFLLHQVCIIPIEEFSAEYVRPQ    981 - 1050
VHCIASYGRFVNQSATCVSLAHETPPTALILDVLSGRPFPHLPQQSSPSVDVLPGVTLKAPQNQVTLRGR   1051 - 1120
VPHLGRYVFVIHFYQAAHPTFPAQVSVDGGWPRAGSFHASFCPHVLGCRDQVIAEGQIEFDISEPEVAAT   1121 - 1190
VKVPEGKSLVLVRVLVVPAENYDYQILHKKSMDKSLEFITNCGKNSFYLDPQTASRFCKNSARSLVAFYH   1191 - 1260
KGALPCECHPTGATGPHCSPEGGQCPCQPNVIGRQCTRCATGHYGFPRCKPCSCGRRLCEEMTGQCRCPP   1261 - 1330
RTVRPQCEVCETHSFSFHPMAGCEGCNCSRRGTIEAAMPECDRDSGQCRCKPRITGRQCDRCASGFYRFP   1331 - 1400
ECVPCNCNRDGTEPGVCDPGTGACLCKENVEGTECNVCREGSFHLDPANLKGCTSCFCFGVNNQCHSSHK   1401 - 1470
RRTKFVDMLGWHLETADRVDIPVSFNPGSNSMVADLQELPATIHSASWVAPTSYLGDKVSSYGGYLTYQA   1471 - 1540
KSFGLPGDMVLLEKKPDVQLTGQHMSIIYEETNTPRPDRLHHGRVHVVEGNFRHASSRAPVSREELMTVL   1541 - 1610
SRLADVRIQGLYFTETQRLTLSEVGLEEASDTGSGRIALAVEICACPPAYAGDSCQGCSPGYYRDHKGLY   1611 - 1680
TGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNSFATGCVVNG   1681 - 1750
GDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSCNSNGQLGSCHPLTGDCINQEPKDSSPAEECD   1751 - 1820
DCDSCVMTLLNDLATMGEQLRLVKSQLQGLSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEG   1821 - 1890
LERELTDLNQEFETLQEKAQVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNN   1891 - 1960
VPSGDFSREWAEAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLNE   1961 - 2030
YEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADSSLLQTNIALQL   2031 - 2100
MEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSLQELAKQLEEIKRNASGDELVR   2101 - 2170
CAVDAATAYENILNAIKAAEDAANRAASASESALQTVIKEDLPRKAKTLSSNSDKLLNEAKMTQKKLKQE   2171 - 2240
VSPALNNLQQTLNIVTVQKEVIDTNLTTLRDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQ   2241 - 2310
TDVERIKDTYGRTQNEDFKKALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQA   2311 - 2380
RDAASKVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYIG   2381 - 2450
MAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATSSKPETPGVYDM   2451 - 2520
DGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNENVLSLYNFKKTFNLNTTEVEP   2521 - 2590
CRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTTVDRGLLFFAENGDRFISLNIEDGKLMVRYKL   2591 - 2660
NSELPKERGVGDAINNGRDHSIQIKIGKLQKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNIS   2661 - 2730
TPAFRGCMKNLKKTSGVVRLNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTF   2731 - 2800
QPSGILLDHQTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQLLR   2801 - 2870
NSKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSLNKPPFLMLLKG   2871 - 2940
STRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQFGDIPTSHLLFKLPQELLKPRS   2941 - 3010
QFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALGTDGKKLRIKSKEKCNDGKWHTVVFGHDGEKG   3011 - 3080
RLVVDGLRAREGSLPGNSTISIRAPVYLGSPPSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSC   3081 - 3150
LGGPLEKGIYFSEEGGHVVLAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMD   3151 - 3220
SGAGGTSTSVTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLTT   3221 - 3290
LRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ                              3291 - 3333
//

Text Mined References (93)

PMID Year Title
25443231 2014 Risk factors and genetics of atrial fibrillation.
25363238 2014 Association of variation in the LAMA3 gene, encoding the alpha-chain of laminin 5, with atopic dermatitis in a German case-control cohort.
25188360 2015 Lung-specific loss of ?3 laminin worsens bleomycin-induced pulmonary fibrosis.
25149502 2014 Biological network inferences for a protection mechanism against familial Creutzfeldt-Jakob disease with E200K pathogenic mutation.
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24675808 2014 Expression microarray analysis reveals alternative splicing of LAMA3 and DST genes in head and neck squamous cell carcinoma.
23907728 2014 The low-abundance transcriptome reveals novel biomarkers, specific intracellular pathways and targetable genes associated with advanced gastric cancer.
23869449 2013 A new homozygous nonsense mutation in LAMA3A underlying laryngo-onycho-cutaneous syndrome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23154389 2013 Regulation of endodermal differentiation of human embryonic stem cells through integrin-ECM interactions.
22963541 2013 Detection of novel LAMA3 mutation in Herlitz junctional epidermolysis bullosa in a Jordanian family.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
22673183 2012 Invasive breast cancer induces laminin-332 upregulation and integrin ?4 neoexpression in myofibroblasts to confer an anoikis-resistant phenotype during tissue remodeling.
22563463 2012 Polymerized laminin-332 matrix supports rapid and tight adhesion of keratinocytes, suppressing cell migration.
22434185 2012 Enamel defects in carriers of a novel LAMA3 mutation underlying epidermolysis bullosa.
22351752 2012 Cell surface proteoglycans syndecan-1 and -4 bind overlapping but distinct sites in laminin ?3 LG45 protein domain.
21940345 The clinical relevance of the expression of the ratio of laminin-5 subchains messenger RNA of hepatocellular carcinoma to non-cancerous liver remnant: a prospective study.
21276136 2011 Downregulation of a newly identified laminin, laminin-3B11, in vascular basement membranes of invasive human breast cancers.
21269460 2011 Initial characterization of the human central proteome.
21034821 2011 Type XVII collagen (BP180) can function as a cell-matrix adhesion molecule via binding to laminin 332.
20372818 2010 Genetic risk for myocardial infarction in Japanese individuals with or without chronic kidney disease.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20036365 2010 Association of genetic variants in SEMA3F, CLEC16A, LAMA3, and PCSK2 with myocardial infarction in Japanese individuals.
19945619 2010 Adhesion and migration, the diverse functions of the laminin alpha3 subunit.
19940114 2010 Bisecting GlcNAc residues on laminin-332 down-regulate galectin-3-dependent keratinocyte motility.
19936049 2009 Exon array analysis of head and neck cancers identifies a hypoxia related splice variant of LAMA3 associated with a poor prognosis.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19773554 2009 Identification of a novel family of laminin N-terminal alternate splice isoforms: structural and functional characterization.
19752234 2009 Human mast cells adhere to and migrate on epithelial and vascular basement membrane laminins LM-332 and LM-511 via alpha3beta1 integrin.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
18664273 2008 Divergent mechanisms underlie Smad4-mediated positive regulation of the three genes encoding the basement membrane component laminin-332 (laminin-5).
18603785 2008 Expression and chain assembly of human laminin-332 in an insect cell-free translation system.
18374450 2008 The classification of inherited epidermolysis bullosa (EB): Report of the Third International Consensus Meeting on Diagnosis and Classification of EB.
17825249 2007 Signaling adaptor protein Crk is indispensable for malignant feature of glioblastoma cell line KMG4.
17482449 2007 Laminin-332 (Laminin-5) is the major motility ligand for B cell chronic lymphocytic leukemia.
17466943 2007 Laminin-incorporated nerve conduits made by plasma treatment for repairing spinal cord injury.
17137774 2007 Laminin-5 activates extracellular matrix production and osteogenic gene focusing in human mesenchymal stem cells.
17071854 2006 Regulation of proliferation and chondrogenic differentiation of human mesenchymal stem cells by laminin-5 (laminin-332).
17000025 2007 Biological function of laminin-5 and pathogenic impact of its deficiency.
16870608 2006 Laminin 5 regulates polycystic kidney cell proliferation and cyst formation.
16757171 2006 Current insights into the formation and breakdown of hemidesmosomes.
16537560 2006 Synthetic D-amino acid peptide inhibits tumor cell motility on laminin-5.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16297184 2005 Proteolytic processing of the laminin alpha3 G domain mediates assembly of hemidesmosomes but has no role on keratinocyte migration.
16219677 2005 CREB-binding protein regulates apoptosis and growth of HMECs grown in reconstituted ECM via laminin-5.
16179086 2005 Uncoordinated production of Laminin-5 chains in airways epithelium of allergic asthmatics.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15854126 2005 Quantitative analysis of laminin 5 gene expression in human keratinocytes.
15695818 2005 Regulation of biological activity and matrix assembly of laminin-5 by COOH-terminal, LG4-5 domain of alpha3 chain.
15373767 2004 Laminin-5 mutational analysis in an Italian cohort of patients with junctional epidermolysis bullosa.
15316072 2004 Globular domains 4/5 of the laminin alpha3 chain mediate deposition of precursor laminin 5.
15149852 2004 Fibroblasts contribute to the deposition of laminin 5 in the extracellular matrix.
15044476 2004 Characterization of laminin 5B and NH2-terminal proteolytic fragment of its alpha3B chain: promotion of cellular adhesion, migration, and proliferation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695139 2003 Aberrant promoter methylation and silencing of laminin-5-encoding genes in breast carcinoma.
14612440 2004 Recombinant human laminin-5 domains. Effects of heterotrimerization, proteolytic processing, and N-glycosylation on alpha3beta1 integrin binding.
12947106 2003 Normal human keratinocytes bind to the alpha3LG4/5 domain of unprocessed laminin-5 through the receptor syndecan-1.
12943669 2003 A missense mutation (G1506E) in the adhesion G domain of laminin-5 causes mild junctional epidermolysis bullosa.
12915477 2003 An unusual N-terminal deletion of the laminin alpha3a isoform leads to the chronic granulation tissue disorder laryngo-onycho-cutaneous syndrome.
12826666 2003 Laminin alpha 3 LG4 module induces matrix metalloproteinase-1 through mitogen-activated protein kinase signaling.
12532327 2003 Differential regulation of cellular adhesion and migration by recombinant laminin-5 forms with partial deletion or mutation within the G3 domain of alpha3 chain.
12482924 2003 Analysis of the interactions between BP180, BP230, plectin and the integrin alpha6beta4 important for hemidesmosome assembly.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12382139 2002 In situ-RT-PCR and immunohistochemistry for the localisation of the mRNA of the alpha 3 chain of laminin and laminin-5 during human organogenesis.
12196012 2002 Identification of neurite outgrowth promoting sites on the laminin alpha 3 chain G domain.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.
11810295 2002 Laminin 5 mutations in junctional epidermolysis bullosa: molecular basis of Herlitz vs. non-Herlitz phenotypes.
11775027 2001 Characterization of morphological and cytoskeletal changes in MCF10A breast epithelial cells plated on laminin-5: comparison with breast cancer cell line MCF7.
11373281 2001 A unique sequence of the laminin alpha 3 G domain binds to heparin and promotes cell adhesion through syndecan-2 and -4.
11326281 2001 Transposable B2 SINE elements can provide mobile RNA polymerase II promoters.
11311202 2001 Amplification of extracellular matrix and oncogenes in tat-transfected human salivary gland cell lines with expression of laminin, fibronectin, collagens I, III, IV, c-myc and p53.
10956663 2000 Spatial regulation and activity modulation of plasmin by high affinity binding to the G domain of the alpha 3 subunit of laminin-5.
10811835 2000 The tetraspan molecule CD151, a novel constituent of hemidesmosomes, associates with the integrin alpha6beta4 and may regulate the spatial organization of hemidesmosomes.
10806203 2000 Bone morphogenetic protein 1 is an extracellular processing enzyme of the laminin 5 gamma 2 chain.
10801807 2000 Structural requirement of carboxyl-terminal globular domains of laminin alpha 3 chain for promotion of rapid cell adhesion and migration by laminin-5.
10366601 1999 Targeted disruption of the LAMA3 gene in mice reveals abnormalities in survival and late stage differentiation of epithelial cells.
10233324 1999 Antiepiligrin (laminin 5) cicatricial pemphigoid associated with an underlying gastric carcinoma producing laminin 5.
9950675 1999 A cell signal pathway involving laminin-5, alpha3beta1 integrin, and mitogen-activated protein kinase can regulate epithelial cell proliferation.
9759651 1998 Molecular analysis of the human laminin alpha3a chain gene (LAMA3a): a strategy for mutation identification and DNA-based prenatal diagnosis in Herlitz junctional epidermolysis bullosa.
9395076 1997 The human alpha3b is a 'full-sized' laminin chain variant with a more widespread tissue expression than the truncated alpha3a.
9205497 1997 A recurrent laminin 5 mutation in British patients with lethal (Herlitz) junctional epidermolysis bullosa: evidence for a mutational hotspot rather than propagation of an ancestral allele.
9151674 1997 The laminin alpha chains: expression, developmental transitions, and chromosomal locations of alpha1-5, identification of heterotrimeric laminins 8-11, and cloning of a novel alpha3 isoform.
9010770 1996 Differential expression of laminin-5/ladsin subunits in human tissues and cancer cell lines and their induction by tumor promoter and growth factors.
8939648 1996 Macromolecular organization of basement membranes.
8618022 1996 A recurrent homozygous nonsense mutation within the LAMA3 gene as a cause of Herlitz junctional epidermolysis bullosa in patients of Pakistani ancestry: evidence for a founder effect.
8586427 1995 Cloning of the laminin alpha 3 chain gene (LAMA3) and identification of a homozygous deletion in a patient with Herlitz junctional epidermolysis bullosa.
8530087 1995 A homozygous nonsense mutation in the alpha 3 chain gene of laminin 5 (LAMA3) in Herlitz junctional epidermolysis bullosa: prenatal exclusion in a fetus at risk.
8494757 1993 Epidermolysis bullosa junctionalis progressiva in three siblings.
8077230 1994 Cloning of the LamA3 gene encoding the alpha 3 chain of the adhesive ligand epiligrin. Expression in wound repair.
7921537 1994 A new nomenclature for the laminins.
7775432 1995 Structural requirement for cell adhesion to kalinin (laminin-5).
7633458 1995 A homozygous nonsense mutation in the alpha 3 chain gene of laminin 5 (LAMA3) in lethal (Herlitz) junctional epidermolysis bullosa.