Property Summary

NCBI Gene PubMed Count 70
PubMed Score 88.73
PubTator Score 79.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group B ependymoma 3.400 4.5e-17
glioblastoma 1.700 2.3e-03
cystic fibrosis 3.870 4.6e-07
primitive neuroectodermal tumor 2.300 6.7e-04
non-small cell lung cancer 1.061 2.5e-06
ulcerative colitis -4.000 2.8e-09
sonic hedgehog group medulloblastoma 1.400 1.1e-02
Breast cancer -1.800 1.0e-12
ovarian cancer 1.700 5.4e-03

Protein-protein Interaction (13)

Gene RIF (32)

PMID Text
25953895 Novel PMCA3 missense mutation co-occurring with a heterozygous mutation in LAMA1 impaired cellular Ca2+ homeostasis in patients with Cerebellar Ataxia.
25885552 Our results indicate that invasion of cervical cancer is accomplished by the remodeling of the interstitial stroma, which process includes decrease and partial replacement of fibronectin and collagens by a laminin-rich matrix
25105227 Identification of biallelic mutations in LAMA1 as the cause of cerebellar dysplasia with cysts in seven affected individuals.
24742657 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
24458132 skin-processed peptides play role in wound healing and antimicrobial response
22919069 Studies indicate that progenitor endothelial cells (ECs), endothelial colony-forming cells (ECFCs), deposit collagen IV, fibronectin, and laminin.
22840390 miR-9 negatively controls lamin A and progerin expression in neural cells.
22693455 we report associations with the LAMA1 and HMG20A (not previously associated at genome-wide significance in Europeans) gene regions with type 2 diabetes risk
22159078 Laminin-alpha1 LG4-5 domain binding to dystroglycan mediates muscle cell survival, growth, and the AP-1 and NF-kappaB transcription factors but also has adverse effects.
21570970 c-Jun/AP-1 activity mediated by JNK, PI3K/Akt and ERK pathways is required for laminin-1-induced neurite outgrowth in human bone marrow mesenchymal stem cells.
21541277 The polymorphism of SNP rs2089760, located in the promoter region of LAMA1, may be associated with high myopia in the Chinese population.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237901 Laminin-derived peptide AG73 regulates migration, invasion, and protease activity of human oral squamous cell carcinoma cells through syndecan-1 and beta1 integrin.
20019771 Abnormal distribution of laminin alpha1 and laminin alpha5 in glomerular basement membrane is correlated with GBM thickening and splitting in human Alport's syndrome.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19672032 Promoter -1030C/T polymorphism of LMNA is a possible genetic predisposition to arterial stiffness in the Japanese population
19587235 These results identify a previously undescribed role of carbohydrate-dependent cell-basement membrane interaction in tumor suppression and its control by beta3GnT1 and LARGE.
19416897 laminin-111 (alpha(1), beta(1), gamma(1)), which is expressed during embryonic development but absent in normal or dystrophic skeletal muscle, increased alpha(7)-integrin expression in mouse and DMD patient myoblasts
18661771 The laminin and laminin gene expression was higher in the aganglionic segment than in the dilated segment, and the expression decreased stepwisely from the aganglionic segment to the normal segment.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18436868 Subepicardial localization of CD117-positive cells and expression of laminin-1 and alpha(6) integrin subunits may all correspond to the activation of regeneration involving an epithelial-mesenchymal transition in adult heart
18162078 Real-time PCR showed that ETOH significantly altered the expression of genes involved in cell adhesion. There was an increase in the expression of alpha and beta Laminins 1, beta Integrins 3 and 5, Secreted phosphoprotein1 and Sarcoglycan epsilon.
17618648 analysis of how distinct acidic clusters and hydrophobic residues in the alternative splice domains X1 and X2 of alpha7 integrins define specificity for laminin isoforms
17307732 analysis of structure and activities reveal differences in laminin G-like domain interactions that should enable dissection of biological roles of different laminin ligands
15885076 adhesion to laminin-1 through alpha6-integrin represents a protective mechanism for melanocytes to withstand UVB damage
12615822 mRNA encoding laminin-alpha1, -beta1, and -gamma1 chains was expressed in 90% of endometriotic lesions.
12393739 Laminins with alpha1, alpha4, and alpha5 chains are compared to determine laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells.
12111806 Alpha 1 laminin was heavily over-expressed in Alzheimer disease frontal cortex, and localized in reactive astrocytes of the grey and white matter, and as punctate deposits in the senile placques of the Alzheimer brain tissue.
11827968 Exposure of cryptic domains in the alpha 1-chain of laminin-1 by elastase stimulates macrophages urokinase and matrix metalloproteinase-9 expression.
11311202 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution
9597096 Treatment with cannabinoids inhibits HIV-1 Tat-enhanced attachment of U937 cells to collagen IV, laminin, or ECM1 proteins, which is linked to the cannabinoid receptor type 2 and the modulation of beta1-integrin and actin distribution

AA Sequence

MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRPVRNPQCRICD      1 - 70
GNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERS     71 - 140
LDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSLINGRPSADD    141 - 210
LSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCP    211 - 280
WDETTKKLQCQCEHNTCGESCNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLN    281 - 350
TAGQFRGGGVCINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN    351 - 420
GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGKACDRCKPGFY    421 - 490
NLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIPSQQDALGGRHQVSINNTAVM    491 - 560
QRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSNLMSHADVIIKGNGLTLSTQAEGLSLQP    561 - 630
YEEYLNVVRLVPENFQDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDL    631 - 700
VVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCE    701 - 770
QCLPGFYGEPSRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT    771 - 840
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACECHVKGSH    841 - 910
SAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVSDGCTDEGQCHCVPGVAGKRC    911 - 980
DRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHTQGVKCEECEDGHWGYDAEVGCQACNCSLVG    981 - 1050
STHHRCDVVTGHCQCKSKFGGRACDQCSLGYRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPC   1051 - 1120
KENVFGPQCNECREGTFALRADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGT   1121 - 1190
TEGVYYQAPDFLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI   1191 - 1260
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYILIKASYGQGL   1261 - 1330
QQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHRGKLPAGSDRGPRPLVAPC   1331 - 1400
VPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYGKVTGSASDCALCACPHSPPASFSPTCVLEG   1401 - 1470
DHDFRCDACLLGYEGKHCERCSSSYYGNPQTPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCD   1471 - 1540
ECEPRHILMETDCVSCDDECVGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENM   1541 - 1610
QKDLGKIKLEGVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT   1611 - 1680
LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPLEELEVLKEAA   1681 - 1750
SHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQEEQNLTSELIVQGRGLIDAA   1751 - 1820
AAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHAAEFQRLADVLYSGLE   1821 - 1890
NIRNVSLNATSAAYVHYNIQSLIEESEELARDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSR   1891 - 1960
KLPGIALELSELRNKTNRFQENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVA   1961 - 2030
GLSQELLNTSASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS   2031 - 2100
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGSSTASDFLAVE   2101 - 2170
MRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEMSSNQKSPTKTSKSPGTANVL   2171 - 2240
DVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGKSIGLWNYIEREGKCRGCFGSSQNEDPSFHF   2241 - 2310
DGSGYSVVEKSLPATVTQIIMLFNTFSPNGLLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDR   2311 - 2380
RYNNGTWYKIAFQRNRKQGVLAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVT   2381 - 2450
TKSFVGCIKNLEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS   2451 - 2520
GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSDGQAHSISLVR   2521 - 2590
NRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMRRSFHGCIKNLIFNLELLDFN   2591 - 2660
SAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQCVVDAALEYVPGAHQFGLTQNSHFILPFNQ   2661 - 2730
SAVRKKLSVELSIRTFASSGLIYYMAHQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTV   2731 - 2800
KTDYVKRKGFITVDGRESPMVTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQ   2801 - 2870
LDKDSPVSAFTVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI   2871 - 2940
GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGAESPHTQSTSV   2941 - 3010
DTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAFELHGVFLHSCPGTES        3011 - 3075
//

Text Mined References (72)

PMID Year Title
25953895 2015 A Novel Mutation in Isoform 3 of the Plasma Membrane Ca2+ Pump Impairs Cellular Ca2+ Homeostasis in a Patient with Cerebellar Ataxia and Laminin Subunit 1? Mutations.
25885552 2015 Remodeling of extracellular matrix by normal and tumor-associated fibroblasts promotes cervical cancer progression.
25171405 2014 A secreted tyrosine kinase acts in the extracellular environment.
25105227 2014 Mutations in LAMA1 cause cerebellar dysplasia and cysts with and without retinal dystrophy.
24458132 2014 Processing of laminin ? chains generates peptides involved in wound healing and host defense.
23658023 2013 Comparative proteomic analysis of supportive and unsupportive extracellular matrix substrates for human embryonic stem cell maintenance.
22919069 2012 The extracellular matrix is a novel attribute of endothelial progenitors and of hypoxic mature endothelial cells.
22840390 2012 Unique preservation of neural cells in Hutchinson- Gilford progeria syndrome is due to the expression of the neural-specific miR-9 microRNA.
22760553 2012 Genome-wide pharmacogenomic study of citalopram-induced side effects in STAR*D.
22693455 2012 Stratifying type 2 diabetes cases by BMI identifies genetic risk variants in LAMA1 and enrichment for risk variants in lean compared to obese cases.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
22159078 2012 Laminin-?1 LG4-5 domain binding to dystroglycan mediates muscle cell survival, growth, and the AP-1 and NF-?B transcription factors but also has adverse effects.
21570970 2011 c-Jun/AP-1 transcription factor regulates laminin-1-induced neurite outgrowth in human bone marrow mesenchymal stem cells: role of multiple signaling pathways.
21541277 2011 The association of a single nucleotide polymorphism in the promoter region of the LAMA1 gene with susceptibility to Chinese high myopia.
20876614 2010 A genome-wide association study reveals susceptibility variants for non-small cell lung cancer in the Korean population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237901 2010 Laminin-derived peptide AG73 regulates migration, invasion, and protease activity of human oral squamous cell carcinoma cells through syndecan-1 and beta1 integrin.
20019771 2009 [Correlation between ultrastructural changes of glomerular basement membrane and abnormal distribution of laminins in patients with Alport's syndrome].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19672032 2009 A promoter polymorphism of lamin A/C gene is an independent genetic predisposition to arterial stiffness in a Japanese general population (the Tanno and Sobetsu study).
19587235 2009 Tumor suppressor function of laminin-binding alpha-dystroglycan requires a distinct beta3-N-acetylglucosaminyltransferase.
19416897 2009 Laminin-111 protein therapy prevents muscle disease in the mdx mouse model for Duchenne muscular dystrophy.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18661771 2008 The relationship between expressions of the laminin gene and RET gene in Hirschsprung's disease.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18436868 2008 CD117-positive cells in adult human heart are localized in the subepicardium, and their activation is associated with laminin-1 and alpha6 integrin expression.
18162078 2008 Ethanol increases fetal human neurosphere size and alters adhesion molecule gene expression.
17618648 2007 Distinct acidic clusters and hydrophobic residues in the alternative splice domains X1 and X2 of alpha7 integrins define specificity for laminin isoforms.
17307732 2007 Crystal structure and cell surface anchorage sites of laminin alpha1LG4-5.
17166913 2007 Vaccinia virus 4c (A26L) protein on intracellular mature virus binds to the extracellular cellular matrix laminin.
16709410 2006 Brain alpha-dystroglycan displays unique glycoepitopes and preferential binding to laminin-10/11.
16677310 2006 Mycobacterium tuberculosis malate synthase is a laminin-binding adhesin.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15885076 2005 Selective down-regulation of the alpha6-integrin subunit in melanocytes by UVB light.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14557481 2003 Laminin isoforms in fetal and adult human adrenal cortex.
12615822 2003 An association of IgG anti-laminin-1 autoantibodies with endometriosis in infertile patients.
12524166 2003 Human acetylcholinesterase binds to mouse laminin-1 and human collagen IV by an electrostatic mechanism at the peripheral anionic site.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393739 2003 Laminin isoform-specific promotion of adhesion and migration of human bone marrow progenitor cells.
12180907 2002 Matrilin-2 interacts with itself and with other extracellular matrix proteins.
12149247 2002 Matriptase-2, a membrane-bound mosaic serine proteinase predominantly expressed in human liver and showing degrading activity against extracellular matrix proteins.
12111806 2002 Differential distribution of laminins in Alzheimer disease and normal human brain tissue.
11827968 2002 Exposure of cryptic domains in the alpha 1-chain of laminin-1 by elastase stimulates macrophages urokinase and matrix metalloproteinase-9 expression.
11798066 2001 Dystroglycan binding to laminin alpha1LG4 module influences epithelial morphogenesis of salivary gland and lung in vitro.
11311202 2001 Amplification of extracellular matrix and oncogenes in tat-transfected human salivary gland cell lines with expression of laminin, fibronectin, collagens I, III, IV, c-myc and p53.
10964500 2000 Posttranslational modifications and beta/gamma chain associations of human laminin alpha1 and laminin alpha5 chains: purification of laminin-3 from placenta.
10934193 2000 Structural and functional analysis of the recombinant G domain of the laminin alpha4 chain and its proteolytic processing in tissues.
10837144 2000 Laminin alpha1-chain shows a restricted distribution in epithelial basement membranes of fetal and adult human tissues.
10620696 2000 Heterologously overexpressed, affinity-purified human meprin alpha is functionally active and cleaves components of the basement membrane in vitro.
10470109 Expression of CD 73 (ecto-5'-nucleotidase) in 165 glioblastomas by immunohistochemistry and electronmicroscopic histochemistry.
9688542 1998 The N-terminal globular domain of the laminin alpha1 chain binds to alpha1beta1 and alpha2beta1 integrins and to the heparan sulfate-containing domains of perlecan.
9647658 1998 The laminin-nidogen complex is a ligand for a specific splice isoform of the transmembrane protein tyrosine phosphatase LAR.
9334356 1997 Laminin alpha1 chain synthesis in the mouse developing lung: requirement for epithelial-mesenchymal contact and possible role in bronchial smooth muscle development.
9169408 1997 Interactions of the amino-terminal noncollagenous (NC1) domain of type VII collagen with extracellular matrix components. A potential role in epidermal-dermal adherence in human skin.
9136074 1997 Interaction between Alzheimer's disease beta A4 precursor protein (APP) and the extracellular matrix: evidence for the participation of heparan sulfate proteoglycans.
9006922 1997 Fibulin-2 binds to the short arms of laminin-5 and laminin-1 via conserved amino acid sequences.
8999915 1997 Characterization of the binding of serum amyloid P to laminin.
8995276 1997 Characterization of high affinity binding between laminin and the acute-phase protein, serum amyloid A.
8601594 1996 Human amnion contains a novel laminin variant, laminin 7, which like laminin 6, covalently associates with laminin 5 to promote stable epithelial-stromal attachment.
8463343 1993 Recombinant laminin G domain mediates myoblast adhesion and heparin binding.
8360181 1993 The extracellular matrix proteins laminin and fibronectin contain binding domains for human plasminogen and tissue plasminogen activator.
7925941 1994 Dystroglycan is a binding protein of laminin and merosin in peripheral nerve.
7698745 1994 Human beta 2 chain of laminin (formerly S chain): cDNA cloning, chromosomal localization, and expression in carcinomas.
3488995 1986 C3d fragment of complement interacts with laminin and binds to basement membranes of glomerulus and trophoblast.
2733383 1989 Human laminin: cloning and sequence analysis of cDNAs encoding A, B1 and B2 chains, and expression of the corresponding genes in human skin and cultured cells.
2591971 1989 Human laminin A chain (LAMA) gene: chromosomal mapping to locus 18p11.3.
2373692 1990 Sulfatide-binding domain of the laminin A chain.
2099832 1990 Distribution and isolation of four laminin variants; tissue restricted distribution of heterotrimers assembled from five different subunits.
2049067 1991 Primary structure of the human laminin A chain. Limited expression in human tissues.
1714537 1991 Molecular cloning of the cDNA encoding human laminin A chain.