Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.19
PubTator Score 13.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
psoriasis 6685 1.2e-44
diabetes mellitus 1663 2.1e-03
tuberculosis 1563 1.7e-02
colon cancer 1475 1.9e-02
active ulcerative colitis 477 2.4e-02

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 2.700 1.2e-44
tuberculosis 1.300 1.7e-02
colon cancer 1.500 1.9e-02
active ulcerative colitis 1.634 2.4e-02
diabetes mellitus 1.400 2.1e-03

Gene RIF (9)

PMID Text
26721477 We suggest that LAIR1 and LAIR2 genetic variants are associated with regulation of gene expression and variable pemphigus foliaceus susceptibility, and show indirect association of LAIR2 differential mRNA expression with pemphigus foliaceus pathogenesis.
24192271 recombinant LAIR-2-Fc inhibits complement-mediated lysis of cells sensitized with anti-HLA antibodies
23691008 the presence of high LAIR-2 levels in 74/80 sera from patients with autoimmune thyroid diseases
23332415 LAIR2-expressing extravillous trophoblasts associate with maternal spiral arterioles undergoing physiologic conversion
22294640 Two markers in two different genes (CNOT3 and LAIR2) showed significant association with ankylosing spondylitis.
20730098 LAIR-2/Fc has the capacity to interfere with platelet-collagen interactions mediated by Glycoprotein VI and the VWF/Glycoprotein Ib axis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19345263 Human collagen II peptides II-17, -27, -30, -35, -38, -42, -49 & -56; and collagen III peptides III-1, 5, -8, -10, -12, -13, -22, -30, -38, -40, -44, -45, and -51 specifically interacted with hLAIR-2 expressed on K562 cells
18209062 LAIR-2 prevents binding of human LAIR-1 to collagens and LAIR-1 cross-linking in vitro, suggesting that the protein has an immunoregulatory function in vivo.

AA Sequence

MSPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRGPVGVQTFRLEREDRAKYKD      1 - 70
SYNVFRLGPSESEARFHIDSVSEGNAGLYRCLYYKPPGWSEHSDFLELLVKESSGGPDSPDTEPGSSAGT     71 - 140
VPGTEASGFDAP                                                              141 - 152
//

Text Mined References (18)

PMID Year Title
26721477 2016 Differential gene expression levels might explain association of LAIR2 polymorphisms with pemphigus.
25416956 2014 A proteome-scale map of the human interactome network.
24192271 2014 Inhibition of the classical and lectin pathway of the complement system by recombinant LAIR-2.
23691008 2013 Serum LAIR-2 is increased in autoimmune thyroid diseases.
23332415 2013 LAIR2-expressing extravillous trophoblasts associate with maternal spiral arterioles undergoing physiologic conversion.
22294640 2012 A high density SNP genotyping approach within the 19q13 chromosome region identifies an association of a CNOT3 polymorphism with ankylosing spondylitis.
20730098 2010 Efficient inhibition of collagen-induced platelet activation and adhesion by LAIR-2, a soluble Ig-like receptor family member.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19345263 2009 Identification of multiple potent binding sites for human leukocyte associated Ig-like receptor LAIR on collagens II and III.
18209062 2008 The soluble leukocyte-associated Ig-like receptor (LAIR)-2 antagonizes the collagen/LAIR-1 inhibitory immune interaction.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10941842 2000 Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.
10229813 1999 Leukocyte-associated Ig-like receptor-1 functions as an inhibitory receptor on cytotoxic T cells.
9285412 1997 LAIR-1, a novel inhibitory receptor expressed on human mononuclear leukocytes.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.