Property Summary

NCBI Gene PubMed Count 56
PubMed Score 55.52
PubTator Score 64.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.096 2.8e-03
cutaneous lupus erythematosus 3.000 2.2e-05
osteosarcoma -2.395 1.9e-04
chronic lymphosyte leukemia -1.100 5.7e-05
astrocytoma 2.000 2.7e-02
glioblastoma 2.600 1.1e-03
tuberculosis and treatment for 6 months -1.700 4.3e-05
non-small cell lung cancer -1.455 2.2e-12
lung cancer -1.800 6.6e-04
interstitial cystitis 1.300 5.4e-03
pediatric high grade glioma 1.300 7.3e-04
pilocytic astrocytoma 1.200 1.3e-05
subependymal giant cell astrocytoma 2.009 1.3e-02
invasive ductal carcinoma 1.377 1.9e-05
lung carcinoma -2.100 1.5e-17
head and neck cancer and chronic obstruc... 1.100 3.6e-04

Gene RIF (32)

PMID Text
26721477 We suggest that LAIR1 and LAIR2 genetic variants are associated with regulation of gene expression and variable pemphigus foliaceus susceptibility, and show indirect association of LAIR2 differential mRNA expression with pemphigus foliaceus pathogenesis.
26700814 A LAIR1 insertion generates broadly reactive antibodies against malaria variant antigens;findings illustrate, with a biologically relevant example, a novel mechanism of antibody diversification by interchromosomal DNA transposition
25915125 The LAIR1-SHP-1-CAMK1-CREB pathway sustains the survival and self-renewal of AML stem cells.
25660999 These data suggest that LAIR-1 has a relevant impact on EOC progression and may be helpful for a better understanding of molecular pathogenesis of cancer.
25275127 HIV-1 Nef downregulates the cell surface expression of leukocyte-associated immunoglobulin-like receptor 1 (LAIR1, CD305)
25247291 C1q-mediated repression of human monocytes is regulated by LAIR-1
24750832 LAIR-1 may play an important role in immune imbalance in children with immune thrombocytopenia.
24585933 a novel pathway for the immunomodulatory functions of SP-D mediated via binding of its collagenous domains to LAIR-1.
24415628 LAIR1 expression is a reliable and inexpensive marker capable of independently predicting time to first treatment in newly diagnosed unselected patients with chronic lymphocytic leukemia.
24399813 The expression of LAIR -1 on pDCs of juvenile systemic lupus erythematosus patients was significantly lower than that of control patients.
24386309 positive association between concentrations of amniotic fluid sLAIR-1 and neonatal lung compliance
24380839 differential role in T-cells and macrophages in patients with rheumatoid arthritis
23093673 C1q is a functional ligand for LAIR-1 restricting immune cell differentiation and activation.
22355402 Loss of LAIR-1 function is associated with systemic lupus erythematosus
21955987 tumor-expressed collagens can bind and trigger immune inhibitory signaling via LAIR-1, suggesting that collagens indeed may affect tumor immune evasion.
21216234 These results suggest that LAIR-1 is a likely candidate for an early marker of megakaryocytes differentiation, and provide initial evidence indicating that LAIR-1 serves as a negative regulator of megakaryocytopoiesis.
21151495 Data show that pDCs isolated from peripheral blood of systemic lupus erithematosus (SLE) patients express lower levels of LAIR-1 while displaying slight but consistent expression of NKp44.
20713462 Studies indicate that Megakaryocyte maturation is accompanied by up-regulation of glycoprotein VI and down-regulation of leukocyte-associated immunoglobulin-like receptor-1.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20007810 unanticipated mechanism of collagen recognition common to LAIR-1 and GPVI
19380792 Mutation of a single residue, arginine 65, dramatically decreases the binding of LAIR-1 to collagens.
19345263 Human collagen II peptides II-17, -30 and -56 and collagen III peptides III-1, -30, -38, -44, -45, and -51 specifically interacted with hLAIR-1 expressed on K562 cells.
18394348 The expression of LAIR-1 is up-regulated in tumor patients, which may contribute to cancer immune escape.
18288129 both constitutive and sIgM-induced phosphorylation of p38 and JNK is inhibited by LAIR-1 through an ITIM-dependent signal; this inhibitory signal is missing when LAIR-1 is not expressed as occurs in HR CLL.
18209062 LAIR-2 prevents binding of human LAIR-1 to collagens and LAIR-1 cross-linking in vitro, suggesting that the protein has an immunoregulatory function in vivo.
18063695 A receptor that potentially is able to regulate multiple steps of an immune response.[REVIEW]
17764536 in cell lines, LAIR-1, which is not expressed on platelets but is present on most hematopoietic cells, inhibits GPVI responses to collagen but not convulxin
17330824 Regulated expression of LAIR-1 and the subsequent change in the threshold for activation may be a mechanism to modulate inhibition of the immune system.
16754721 Collagens are functional ligands for LAIR-1 and directly inhibit immune cell activation in vitro.
15065762 structure and role of LAIR (review)
12757266 NK cells derived from a boy with CAEBV showed decreased cytotoxic function and impaired IFN-gamma secretion. In addition, the NK cells lacked expression of the broadly expressed NK receptor, LAIR-1.
12072189 LAIR-1 exerts inhibitory functions on antigen-specific effector T cells

AA Sequence

MSPHPTALLGLVLCLAQTIHTQEEDLPRPSISAEPGTVIPLGSHVTFVCRGPVGVQTFRLERESRSTYND      1 - 70
TEDVSQASPSESEARFRIDSVSEGNAGPYRCIYYKPPKWSEQSDYLELLVKETSGGPDSPDTEPGSSAGP     71 - 140
TQRPSDNSHNEHAPASQGLKAEHLYILIGVSVVFLFCLLLLVLFCLHRQNQIKQGPPRSKDEEQKPQQRP    141 - 210
DLAVDVLERTADKATVNGLPEKDRETDTSALAAGSSQEVTYAQLDHWALTQRTARAVSPQSTKPMAESIT    211 - 280
YAAVARH                                                                   281 - 287
//

Text Mined References (59)

PMID Year Title
26721477 2016 Differential gene expression levels might explain association of LAIR2 polymorphisms with pemphigus.
26700814 2016 A LAIR1 insertion generates broadly reactive antibodies against malaria variant antigens.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915125 2015 The ITIM-containing receptor LAIR1 is essential for acute myeloid leukaemia development.
25660999 2015 Leukocyte-associated immunoglobulin-like receptor-1 expressed in epithelial ovarian cancer cells and involved in cell proliferation and invasion.
25247291 2015 C1q-mediated repression of human monocytes is regulated by leukocyte-associated Ig-like receptor 1 (LAIR-1).
24750832 2014 [Expression of leukocyte-associated Ig-like receptor-1 in children with immune thrombocytopenia].
24585933 2014 Leukocyte-associated Ig-like receptor-1 is a novel inhibitory receptor for surfactant protein D.
24415628 2014 Clinical significance of LAIR1 (CD305) as assessed by flow cytometry in a prospective series of patients with chronic lymphocytic leukemia.
24399813 2014 Simultaneous changes in serum HMGB1 and IFN-? levels and in LAIR-1 expression on plasmatoid dendritic cells of patients with juvenile SLE. New therapeutic options?
24386309 2013 Soluble leukocyte-Associated Ig-like Receptor-1 in amniotic fluid is of fetal origin and positively associates with lung compliance.
24380839 2014 The role of LAIR-1 (CD305) in T cells and monocytes/macrophages in patients with rheumatoid arthritis.
23778340 2013 Expression of leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) on osteoclasts and its potential role in rheumatoid arthritis.
23691008 2013 Serum LAIR-2 is increased in autoimmune thyroid diseases.
23649467 2013 Leukemia surfaceome analysis reveals new disease-associated features.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23093673 2012 C1q limits dendritic cell differentiation and activation by engaging LAIR-1.
22355402 2012 Defective expression and function of the leukocyte associated Ig-like receptor 1 in B lymphocytes from systemic lupus erythematosus patients.
21955987 2011 Tumor-expressed collagens can modulate immune cell function through the inhibitory collagen receptor LAIR-1.
21216234 2011 Leukocyte-associated immunoglobulin-like receptor-1 is expressed on human megakaryocytes and negatively regulates the maturation of primary megakaryocytic progenitors and cell line.
21151495 2010 The immune inhibitory receptor LAIR-1 is highly expressed by plasmacytoid dendritic cells and acts complementary with NKp44 to control IFN? production.
20713462 2010 Co-expression of the collagen receptors leukocyte-associated immunoglobulin-like receptor-1 and glycoprotein VI on a subset of megakaryoblasts.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20007810 2010 Crystal structure and collagen-binding site of immune inhibitory receptor LAIR-1: unexpected implications for collagen binding by platelet receptor GPVI.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19380792 2009 A single residue, arginine 65, is critical for the functional interaction of leukocyte-associated inhibitory receptor-1 with collagens.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19345263 2009 Identification of multiple potent binding sites for human leukocyte associated Ig-like receptor LAIR on collagens II and III.
18394348 2008 [The up-regulated expression of LAIR-1 in tumor patients PBMC].
18288129 2008 Lack of the leukocyte-associated Ig-like receptor-1 expression in high-risk chronic lymphocytic leukaemia results in the absence of a negative signal regulating kinase activation and cell division.
18209062 2008 The soluble leukocyte-associated Ig-like receptor (LAIR)-2 antagonizes the collagen/LAIR-1 inhibitory immune interaction.
18063695 2008 The inhibitory collagen receptor LAIR-1 (CD305).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17764536 2007 Collagen promotes sustained glycoprotein VI signaling in platelets and cell lines.
17567994 2007 Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions.
17330824 2007 Regulated expression of the inhibitory receptor LAIR-1 on human peripheral T cells during T cell activation and differentiation.
16754721 2006 Collagens are functional, high affinity ligands for the inhibitory immune receptor LAIR-1.
16380958 2006 Leukocyte-associated Ig-like receptor-1 has SH2 domain-containing phosphatase-independent function and recruits C-terminal Src kinase.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15950745 2005 The inhibitory leukocyte-associated Ig-like receptor-1 (LAIR-1) is expressed at high levels by human naive T cells and inhibits TCR mediated activation.
15939744 2005 Inhibitory receptors CD85j, LAIR-1, and CD152 down-regulate immunoglobulin and cytokine production by human B lymphocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15065762 Leukocyte associated Ig-like receptor (LAIR).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14604962 2004 Mechanisms of hypergammaglobulinemia and impaired antigen-specific humoral immunity in HIV-1 infection.
14565933 2003 Differential contribution of the immunoreceptor tyrosine-based inhibitory motifs of human leukocyte-associated Ig-like receptor-1 to inhibitory function and phosphatase recruitment.
12757266 2003 Chronic active Epstein-Barr virus infection associated with low expression of leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) on natural killer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12072189 2002 Surface density expression of the leukocyte-associated Ig-like receptor-1 is directly related to inhibition of human T-cell functions.
11160222 2001 Constitutive association of SHP-1 with leukocyte-associated Ig-like receptor-1 in human T cells.
11069054 2000 Engagement of the leukocyte-associated Ig-like receptor-1 induces programmed cell death and prevents NF-kappaB nuclear translocation in human myeloid leukemias.
10764762 2000 Identification and characterization of leukocyte-associated Ig-like receptor-1 as a major anchor protein of tyrosine phosphatase SHP-1 in hematopoietic cells.
10660620 2000 PILRalpha, a novel immunoreceptor tyrosine-based inhibitory motif-bearing protein, recruits SHP-1 upon tyrosine phosphorylation and is paired with the truncated counterpart PILRbeta.
10540327 1999 Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is differentially expressed during human B cell differentiation and inhibits B cell receptor-mediated signaling.
10453657 1999 LAIR-1, a widely distributed human ITIM-bearing receptor on hematopoietic cells.
10404045 1999 Why so many coinhibitory receptors?
10229813 1999 Leukocyte-associated Ig-like receptor-1 functions as an inhibitory receptor on cytotoxic T cells.
9692876 1998 p40/LAIR-1 regulates the differentiation of peripheral blood precursors to dendritic cells induced by granulocyte-monocyte colony-stimulating factor.
9285412 1997 LAIR-1, a novel inhibitory receptor expressed on human mononuclear leukocytes.