Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.24
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Galloway Mowat syndrome 6 0.0 0.0
Disease Target Count Z-score Confidence
Galloway-Mowat syndrome 15 5.478 2.7
Shipyard eye 15 4.051 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 1.400 2.5e-09
breast carcinoma 1.200 5.3e-27
ductal carcinoma in situ 1.200 9.5e-04
invasive ductal carcinoma 1.900 6.9e-04
malignant mesothelioma 1.100 1.3e-04
ovarian cancer 1.500 4.3e-05
psoriasis 1.600 1.7e-04

Synonym

Accession Q14657 Q5HY39 Q8IZ78
Symbols CVG5
ESO3
Pcc1
ITBA2
GAMOS2
DXS9879E
DXS9951E

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA

AA Sequence

MRDADADAGGGADGGDGRGGHSCRGGVDTAAAPAGGAPPAHAPGPGRDAASAARGSRMRPHIFTLSVPFP      1 - 70
TPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPP     71 - 140
VSR                                                                       141 - 143
//

Text Mined References (14)

PMID Year Title