Property Summary

Ligand Count 64
NCBI Gene PubMed Count 19
PubMed Score 10.48
PubTator Score 5.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
medulloblastoma 720 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.200 4.3e-07
gastric carcinoma 1.100 3.1e-02
group 3 medulloblastoma 1.300 6.1e-03
ovarian cancer -2.100 5.7e-13
pituitary cancer 1.100 1.2e-02
tuberculosis and treatment for 3 months 1.100 5.2e-05

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDENEMENVKKATATTTWMVPTAQ      1 - 70
EAPTSPPSSRPVFPPAYWTSPPGCPTVFSEKTGMPFRLKDPVKVEGLQFCENCCQYGNVDECLSGGNYCS     71 - 140
QNCARHIKDKDQKEERDVEEDNEEEDPKCSRKKKPKLSLKADTKEDGEERDDEMENKQDVRILRGSQRAR    141 - 210
RKRRGDSAVLKQGLPPKGKKAWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSV    211 - 280
YCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCK    281 - 350
AQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASS    351 - 420
PHIHPVGWCKEHRRTLITPPGYPNVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPM    421 - 490
FIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLSPLELMEASEHGGCST    491 - 560
PGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRLSGEMPPASPSFPRNKRTDANESSSSPEIRD    561 - 630
QHADDVKEDFEERTESEMRTSHEARGAREEPTVQQAQRRSAVFLSFKSPIPCLPLRWEQQSKLLPTVAGI    631 - 700
PASKVSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFK    701 - 770
AAEKNSHNEL                                                                771 - 780
//

Text Mined References (25)

PMID Year Title