Property Summary

NCBI Gene PubMed Count 23
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (16)

PMID Text
26716650 Our results show that L1-ORF2p is overexpressed in tumor and in preneoplastic colon and prostate tissues; this latter finding suggests that ORF2p could be considered as a potential early diagnostic biomarker.
26448937 The %(m)C(u)C and %(u)C(m)C of LINE-1s may be promising markers for monitoring hydatidiform moles before progression to GTN.
26259033 LINE-1 contributes to the genetic evolution of Pancreatic ductal adenocarcinoma (PDAC) and suggest that somatic insertions are acquired discontinuously in gastrointestinal neoplasms.
26172297 As a global epigenetic change, LINE-1 hypomethylation in normal colon mucosa might be associated with a worse outcome in certain Chinese patients with colon cancer.
25782871 LINE-1 hypomethylation is associated with Helicobacter pylori infection in gastric mucosa
25647737 Suggest that LINE-1 hypermethylation in peripheral blood of melanoma patients is a potential epigenetic biomarker for metastasis occurrence.
25120789 LINE-1 methylation is not correlated with the clinical characteristics of aldosterone-producing adenoma
24971511 Alu and LINE-1 hypomethylation is associated with HER2 enriched subtype of breast cancer
24304685 LINE-1 hypomethylation is an early molecular event involved in ovarian endometrioid adenocarcinoma and ovarian clear cell carcinoma malignant transformation.
24150097 It is a repetitive DNA retrotransposon that duplicates via a copy-and-paste genetic mechanism and its methylation levels is related to prognosis of patients with gastrointestinal neoplasm.
23938260 Overall, Parkinson disease was not associated with percent methylation of the LINE-1 promoter. However, the predictable inverse association between PD and ever smoking tobacco was strongest for men and women with the lowest LINE-1 promoter methylation
23101622 Study used a method to amplify genomes of single neurons from human brains and found that LINE-1 is not a major generator of neuronal diversity in cortex and caudate in humans.
23057747 L1 is typically quiescent in most somatic cell types, in developing neurons, however, L1 can express and retrotranspose at high frequency. [Review]
22672592 Lower LINE-1 methylation levels are associated with increased risk of TOF and may provide important clues for the development of tetralogy of fallot .
20846497 The study demonstrated that HILI along with piRNAs plays a role in LINE1 suppression in Hela cancer cell line.
19956846 frequent combined aberrant methylation of the IGF2-H19 locus and LINE1 in the vast majority of ovarian carcinoma samples suggests that these changes are important events in tumorigenesis

AA Sequence

MGKKQNRKTGNSKTQSASPPPKERSSSPATEQSWMENDFDELREEGFRRSNYSELREDIQTKGKEVENFE      1 - 70
KNLEECITRITNTEKCLKELMELKTKARELREECRSLRSRCDQLEERVSAMEDEMNEMKREGKFREKRIK     71 - 140
RNEQSLQEIWDYVKRPNLRLIGVPESDVENGTKLENTLQDIIQENFPNLARQANVQIQEIQRTPQRYSSR    141 - 210
RATPRHIIVRFTKVEMKEKMLRAAREKGRVTLKGKPIRLTADLSAETLQARREWGPIFNILKEKNFQPRI    211 - 280
SYPAKLSFISEGEIKYFIDKQMLRDFVTTRPALKELLKEALNMERNNRYQPLQNHAKM                281 - 338
//

Text Mined References (28)

PMID Year Title
26716650 2016 Enhanced expression of LINE-1-encoded ORF2 protein in early stages of colon and prostate transformation.
26448937 2015 LINE-1 Methylation Patterns as a Predictor of Postmolar Gestational Trophoblastic Neoplasia.
26259033 2015 Retrotransposon insertions in the clonal evolution of pancreatic ductal adenocarcinoma.
26172297 2015 LINE-1 hypomethylation in normal colon mucosa is associated with poor survival in Chinese patients with sporadic colon cancer.
25782871 2015 Relationship between LINE-1 hypomethylation and Helicobacter pylori infection in gastric mucosae.
25647737 2015 LINE-1 hypermethylation in peripheral blood of cutaneous melanoma patients is associated with metastasis.
25120789 2014 Decreased LINE-1 methylation levels in aldosterone-producing adenoma.
24971511 2014 Alu and LINE-1 hypomethylation is associated with HER2 enriched subtype of breast cancer.
24304685 2014 Differences in LINE-1 methylation between endometriotic ovarian cyst and endometriosis-associated ovarian cancer.
24267889 2013 Affinity proteomics reveals human host factors implicated in discrete stages of LINE-1 retrotransposition.
24150097 2014 Clinical implications of the LINE-1 methylation levels in patients with gastrointestinal cancer.
23938260 2012 LINE-1 DNA methylation, smoking and risk of Parkinson's disease.
23101622 2012 Single-neuron sequencing analysis of L1 retrotransposition and somatic mutation in the human brain.
23057747 2012 LINE-1 retrotransposition in the nervous system.
22672592 2012 LINE-1 methylation status and its association with tetralogy of fallot in infants.
21937507 2012 Polymerization and nucleic acid-binding properties of human L1 ORF1 protein.
21822284 2011 Trimeric structure and flexibility of the L1ORF1 protein in human L1 retrotransposition.
20846497 2010 Identification of piRNAs in Hela cells by massive parallel sequencing.
19956846 2010 Frequent aberrant methylation of the imprinted IGF2/H19 locus and LINE1 hypomethylation in ovarian carcinoma.
19139409 2009 Non-LTR retrotransposons encode noncanonical RRM domains in their first open reading frame.
17562864 2007 LINE-1 ORF1 protein localizes in stress granules with other RNA-binding proteins, including components of RNA interference RNA-induced silencing complex.
16183655 2005 Ribonucleoprotein particle formation is necessary but not sufficient for LINE-1 retrotransposition.
11158327 2001 Human L1 retrotransposition: cis preference versus trans complementation.
10655552 2000 A polymorphic L1 retroposon insertion in the centromere of the human Y chromosome.
10401005 1999 Full-length human L1 insertions retain the capacity for high frequency retrotransposition in cultured cells.
8945518 1996 High frequency retrotransposition in cultured mammalian cells.
2497061 1989 Characterization of a nondeleterious L1 insertion in an intron of the human factor VIII gene and further evidence of open reading frames in functional L1 elements.
1662412 1991 Isolation of an active human transposable element.