Property Summary

NCBI Gene PubMed Count 18
PubMed Score 34.90
PubTator Score 21.30

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (6)

PMID Text
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of kynureninase (KYNU) in primary human brain microvascular endothelial cells
22012986 A rare variant at the KYNU gene is associated with essential hypertension in the Han Chinese population.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16080802 The Lys412Glu polymorphism of the KYNU gene in a hypertensive candidate chromosomal region is associated with essential hypertension in Han Chinese.
16080802 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY      1 - 70
FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN     71 - 140
LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK    141 - 210
EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA    211 - 280
GAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFK    281 - 350
QATMKALRKKSVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK    351 - 420
RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN                             421 - 465
//

Text Mined References (25)

PMID Year Title
25343990 2015 Genome-wide association study of selenium concentrations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22012986 2011 A rare variant at the KYNU gene is associated with kynureninase activity and essential hypertension in the Han Chinese population.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17334708 2007 Xanthurenic aciduria due to a mutation in KYNU encoding kynureninase.
17300176 2007 Crystal structure of Homo sapiens kynureninase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16080802 2005 [A polymorphism of kynureninase gene in a hypertensive candidate chromosomal region is associated with essential hypertension].
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14704851 2004 Enzymology of NAD+ homeostasis in man.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11985583 2002 Purification and biochemical characterization of some of the properties of recombinant human kynureninase.
9291104 1997 Different kynurenine pathway enzymes limit quinolinic acid formation by various human cell types.
9180257 1997 Cloning and recombinant expression of rat and human kynureninase.
8706755 1996 Isolation and expression of a cDNA clone encoding human kynureninase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6468727 1984 Intracellular localization and characterization of 3-hydroxykynureninase in human liver.
1939450 1991 High-performance liquid chromatographic assay of human lymphocyte kynureninase activity levels.