| Tchem | Kynureninase |
Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3-hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3-hydroxyanthranilic acid (3-OHAA), respectively. Has a preference for the L-3-hydroxy form. Also has cysteine-conjugate-beta-lyase activity.
Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Comments
| Disease | Target Count |
|---|---|
| IGA Glomerulonephritis | 454 |
| Inflammation | 109 |
| Neurodegenerative Disorders | 37 |
| Disease | Target Count |
|---|---|
| Hydroxykynureninuria | 1 |
| PMID | Text | |
|---|---|---|
| 24667918 | Microarray analysis indicates HIV-1 Tat-induced upregulation of kynureninase (KYNU) in primary human brain microvascular endothelial cells | |
| 22012986 | A rare variant at the KYNU gene is associated with essential hypertension in the Han Chinese population. | |
| 20877624 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 16080802 | The Lys412Glu polymorphism of the KYNU gene in a hypertensive candidate chromosomal region is associated with essential hypertension in Han Chinese. | |
| 16080802 | Observational study of gene-disease association. (HuGE Navigator) |
MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY 1 - 70 FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN 71 - 140 LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK 141 - 210 EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA 211 - 280 GAGGIAGAFIHEKHAHTIKPALVGWFGHELSTRFKMDNKLQLIPGVCGFRISNPPILLVCSLHASLEIFK 281 - 350 QATMKALRKKSVLLTGYLEYLIKHNYGKDKAATKKPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEK 351 - 420 RGVVCDKRNPNGIRVAPVPLYNSFHDVYKFTNLLTSILDSAETKN 421 - 465 //
| PMID | Year | Title | |
|---|---|---|---|
| 25343990 | 2015 | Genome-wide association study of selenium concentrations. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. | |
| 22012986 | 2011 | A rare variant at the KYNU gene is associated with kynureninase activity and essential hypertension in the Han Chinese population. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 20877624 | 2010 | Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. | |
| 17334708 | 2007 | Xanthurenic aciduria due to a mutation in KYNU encoding kynureninase. | |
| 17300176 | 2007 | Crystal structure of Homo sapiens kynureninase. | |
| 17207965 | 2007 | hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes. | |
| 16712791 | 2006 | Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags. | |
| 16080802 | 2005 | [A polymorphism of kynureninase gene in a hypertensive candidate chromosomal region is associated with essential hypertension]. | |
| 15815621 | 2005 | Generation and annotation of the DNA sequences of human chromosomes 2 and 4. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14704851 | 2004 | Enzymology of NAD+ homeostasis in man. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11985583 | 2002 | Purification and biochemical characterization of some of the properties of recombinant human kynureninase. | |
| 9291104 | 1997 | Different kynurenine pathway enzymes limit quinolinic acid formation by various human cell types. | |
| 9180257 | 1997 | Cloning and recombinant expression of rat and human kynureninase. | |
| 8706755 | 1996 | Isolation and expression of a cDNA clone encoding human kynureninase. | |
| 8125298 | 1994 | Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides. | |
| 6468727 | 1984 | Intracellular localization and characterization of 3-hydroxykynureninase in human liver. | |
| 1939450 | 1991 | High-performance liquid chromatographic assay of human lymphocyte kynureninase activity levels. |
