Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.53
PubTator Score 8.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.250 4.5e-03
Multiple myeloma 1.290 3.1e-03
adrenocortical carcinoma -1.017 3.0e-03
ovarian cancer -1.200 6.7e-04

Gene RIF (5)

PMID Text
25231977 human KAT III/CCBL2 possesses cysteine S-conjugate beta-lyase activity, as does mouse KAT II
21492941 The haplotype of KAT III gene CGCTCT may have effect on the function of this enzyme in formation of kynurenic acid in some patients with major depressive episodes.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, it was found that this protein is differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQ      1 - 70
GFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFN     71 - 140
TIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKA    141 - 210
IILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGK    211 - 280
TFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKR    281 - 350
DRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET    351 - 420
KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS                                        421 - 454
//

Text Mined References (18)

PMID Year Title
25231977 2014 Kynurenine aminotransferase III and glutamine transaminase L are identical enzymes that have cysteine S-conjugate ?-lyase activity and can transaminate L-selenomethionine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21492941 2011 The kynurenine pathway in major depression: haplotype analysis of three related functional candidate genes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16376499 2006 Characterization of kynurenine aminotransferase III, a novel member of a phylogenetically conserved KAT family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10441733 1999 Genomic organization and expression analysis of mouse kynurenine aminotransferase II, a possible factor in the pathophysiology of Huntington's disease.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.