Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.67
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 4.2e-03
Disease Target Count Z-score Confidence
Brain cancer 30 0.0 0.9
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 42 5.015 2.5

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.500 4.2e-03

Gene RIF (2)

AA Sequence

MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTL      1 - 70
VEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDT     71 - 140
VSPSLSPGFEDLSHVQPGSPAINGRSQTDDEEMTGE                                      141 - 176
//

Text Mined References (16)

PMID Year Title