Property Summary

NCBI Gene PubMed Count 40
PubMed Score 78.99
PubTator Score 45.67

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.900 2.1e-02
Waldenstrons macroglobulinemia 1.264 2.5e-02
osteosarcoma 2.873 6.6e-08
lung cancer 1.200 1.6e-03
subependymal giant cell astrocytoma 1.333 3.6e-02
Pick disease 1.600 7.2e-06
progressive supranuclear palsy -1.200 1.2e-02
acute myeloid leukemia 1.100 4.0e-02
ovarian cancer 2.100 8.9e-05

Gene RIF (12)

PMID Text
22679391 Kinectin may have the ability to anchor mRNAs to the surface of the endoplasmic reticulum.
22184201 The kinesin-1 deficiency weakened intercellular adhesion, despite the maintenance of adherens junctions and other desmosome components at the plasma membrane.
21305317 The genes identified KTN1, ROCK1, and ZAK may be responsible for loss of cellular homeostasis in giant cells tumors of bone
21111237 Kinectin is concentrated in the perinuclear sheets of the endoplasmic reticulum by interacting with polysomes. Kinectin may play a role in determinining the morphology of the endoplasmic reticulum.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19472918 A large number of variations were found in many of the genes (myozenin 1, gamma-filamin, kinectin-1) in patients with limb-girdle muscular dystrophies and controls.
19472918 Observational study of gene-disease association. (HuGE Navigator)
17013387 When kinesin binds with both heads to the microtubule, the neck linkers in the rear and forward heads extend forward and backward. This supports the notion that neck linker movements accompany the 'hand-over-hand' motion of the two motor domains.
16950774 anchoring the elongation factor-1 complex onto endoplasmic reticulum via EF-1delta/kinectin interaction is important for regulating protein synthesis in eukaryotic cells
16890462 The data suggests that both KNT and KNTvd4(-) participate in microtubule-dependent secretion of amylin in islet beta-cells.
11973345 kinectin is markedly enriched at integrin-based adhesion complexes, induced by clustering integrins with fibronectin-coated beads
10850414 The presence of coiled-coil domains in the ktn1/ret fusion protein (PTC8) suggests ligand-independent dimerization and thus constitutive activation of the ret tyrosine kinase domain.

AA Sequence

MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNG      1 - 70
NLHESDSESVPRDFKLSDALAVEDDQVAPVPLNVVETSSSVRERKKKEKKQKPVLEEQVIKESDASKIPG     71 - 140
KKVEPVPVTKQPTPPSEAAASKKKPGQKKSKNGSDDQDKKVETLMVPSKRQEALPLHQETKQESGSGKKK    141 - 210
ASSKKQKTENVFVDEPLIHATTYIPLMDNADSSPVVDKREVIDLLKPDQVEGIQKSGTKKLKTETDKENA    211 - 280
EVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQDALKKSSKGELTTLIHQLQEKDKLLAAVKEDAAA    281 - 350
TKDRCKQLTQEMMTEKERSNVVITRMKDRIGTLEKEHNVFQNKIHVSYQETQQMQMKFQQVREQMEAEIA    351 - 420
HLKQENGILRDAVSNTTNQLESKQSAELNKLRQDYARLVNELTEKTGKLQQEEVQKKNAEQAATQLKVQL    421 - 490
QEAERRWEEVQSYIRKRTAEHEAAQQDLQSKFVAKENEVQSLHSKLTDTLVSKQQLEQRLMQLMESEQKR    491 - 560
VNKEESLQMQVQDILEQNEALKAQIQQFHSQIAAQTSASVLAEELHKVIAEKDKQIKQTEDSLASERDRL    561 - 630
TSKEEELKDIQNMNFLLKAEVQKLQALANEQAAAAHELEKMQQSVYVKDDKIRLLEEQLQHEISNKMEEF    631 - 700
KILNDQNKALKSEVQKLQTLVSEQPNKDVVEQMEKCIQEKDEKLKTVEELLETGLIQVATKEEELNAIRT    701 - 770
ENSSLTKEVQDLKAKQNDQVSFASLVEELKKVIHEKDGKIKSVEELLEAELLKVANKEKTVQDLKQEIKA    771 - 840
LKEEIGNVQLEKAQQLSITSKVQELQNLLKGKEEQMNTMKAVLEEKEKDLANTGKWLQDLQEENESLKAH    841 - 910
VQEVAQHNLKEASSASQFEELEIVLKEKENELKRLEAMLKERESDLSSKTQLLQDVQDENKLFKSQIEQL    911 - 980
KQQNYQQASSFPPHEELLKVISEREKEISGLWNELDSLKDAVEHQRKKNNDLREKNWEAMEALASTEKML    981 - 1050
QDKVNKTSKERQQQVEAVELEAKEVLKKLFPKVSVPSNLSYGEWLHGFEKKAKECMAGTSGSEEVKVLEH   1051 - 1120
KLKEADEMHTLLQLECEKYKSVLAETEGILQKLQRSVEQEENKWKVKVDESHKTIKQMQSSFTSSEQELE   1121 - 1190
RLRSENKDIENLRREREHLEMELEKAEMERSTYVTEVRELKDLLTELQKKLDDSYSEAVRQNEELNLLKA   1191 - 1260
QLNETLTKLRTEQNERQKVAGDLHKAQQSLELIQSKIVKAAGDTTVIENSDVSPETESSEKETMSVSLNQ   1261 - 1330
TVTQLQQLLQAVNQQLTKEKEHYQVLE                                              1331 - 1357
//

Text Mined References (50)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22679391 2012 p180 promotes the ribosome-independent localization of a subset of mRNA to the endoplasmic reticulum.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22184201 2011 Desmosomal cadherins utilize distinct kinesins for assembly into desmosomes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21305317 2011 Differentially expressed genes in giant cell tumor of bone.
21269460 2011 Initial characterization of the human central proteome.
21111237 2010 Mechanisms determining the morphology of the peripheral ER.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17013387 2006 Single-molecule observations of neck linker conformational changes in the kinesin motor protein.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16950774 2006 Kinectin-dependent assembly of translation elongation factor-1 complex on endoplasmic reticulum regulates protein synthesis.
16890462 2006 Kinectin participates in microtubule-dependent hormone secretion in pancreatic islet beta-cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15060627 2004 Multiple variants and a differential splicing pattern of kinectin in human hepatocellular carcinoma.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12773547 2003 Kinectin anchors the translation elongation factor-1 delta to the endoplasmic reticulum.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11973345 2002 Integrin clustering induces kinectin accumulation.
11689693 2001 Kinectin is a key effector of RhoG microtubule-dependent cellular activity.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11058868 2000 Identification of differentially expressed genes in human melanoma cells with acquired resistance to various antineoplastic drugs.
10913441 2000 Kinectin-kinesin binding domains and their effects on organelle motility.
10850414 2000 Translocation t(10;14)(q11.2:q22.1) fusing the kinetin to the RET gene creates a novel rearranged form (PTC8) of the RET proto-oncogene in radiation-induced childhood papillary thyroid carcinoma.
10692099 2000 Kinesin and kinectin can associate with the melanosomal surface and form a link with microtubules in normal human melanocytes.
9605849 1997 Assignment of the human kinectin gene (KTN1), encoding a kinesin-binding protein, to chromosome 14 band q22.1 by in situ hybridization.
9535835 1998 Analysis of RhoA-binding proteins reveals an interaction domain conserved in heterotrimeric G protein beta subunits and the yeast response regulator protein Skn7.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8769096 1996 Interaction of the Rho family small G proteins with kinectin, an anchoring protein of kinesin motor.
8575822 1996 The CG-1 gene, a member of the kinectin and ES/130 family, maps to human chromosome band 14q22.
8039706 1994 Cloning of a gene encoding a human leukocyte protein characterised by extensive heptad repeats.
7787244 1995 Characterization of kinectin, a kinesin-binding protein: primary sequence and N-terminal topogenic signal analysis.
7787243 1995 Molecular cloning and characterization of human kinectin.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.