Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.94
PubTator Score 4.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 1.3e-05
cystic fibrosis 1696 6.3e-03
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.8
Disease Target Count Z-score Confidence
Thoracic aortic aneurysm 15 3.614 1.8
Ameloblastoma 24 3.389 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
cystic fibrosis 2.500 6.3e-03
non-small cell lung cancer 2.153 1.3e-05

Gene RIF (1)

AA Sequence

MKIPVLPAVVLLSLLVLHSAQGATLGGPEEESTIENYASRPEAFNTPFLNIDKLRSAFKADEFLNWHALF      1 - 70
ESIKRKLPFLNWDAFPKLKGLRSATPDAQ                                              71 - 99
//

Text Mined References (9)

PMID Year Title