Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.7e-04

AA Sequence

MTHCCSPCCQPTCCRTTCCRTTCWKPTTVTTCSSTPCCQPACCVSSCCQPCCRPTCCQNTCCRTTCCQPT      1 - 70
CVTSCCQPSCCSTPCCQPTCCGSSCCGQTSCGSSCGQSSSCAPVYCRRTCYYPTTVCLPGCLNQSCGSNC     71 - 140
CQPCCRPACCETTCCRTTCFQPTCVSSCCQPSCC                                        141 - 174
//

Text Mined References (5)

PMID Year Title