Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.0e-04
diabetes mellitus 1663 1.7e-02

Synonym

Accession Q9BYR2
Symbols KAP4.5
KRTAP4.5

Gene

 GO Component (1)

 GO Process (2)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MVSSCCGSVSSEQSCGLENCCRPSCCQTTCCRTTCCRPSCCKPQCCQSVCYQPTCCHPSCCISSCCRPYC      1 - 70
CESSCCRPCCCQTTCCRTTCCRTTCCCPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSCCHPSCCESSC     71 - 140
CRPCCCVRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC                                 141 - 181
//

Text Mined References (5)

PMID Year Title
21916889 2011 Hair greying is associated with active hair growth.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15955084 2005 Size polymorphisms in the human ultrahigh sulfur hair keratin-associated protein 4, KAP4, gene family.
11279113 2001 Characterization of a cluster of human high/ultrahigh sulfur keratin-associated protein genes embedded in the type I keratin gene domain on chromosome 17q12-21.