Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.10

Knowledge Summary


No data available


Accession Q3LHN0
Symbols KAP25.1

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease

AA Sequence

HSFQPISFMHSSFQPACSDFVGWQSPFLRRTC                                           71 - 102

Text Mined References (1)

PMID Year Title