Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.7e-04

Synonym

Accession Q52LG2
Symbols KAP13-2

PANTHER Protein Class (1)

Gene RIF (1)

AA Sequence

MSYNCCSGNFSSRSCGDYLRYPASSRGFSYPSNLVYSTDLCSPSTCQLGSSLYRGCQEICWEPTSCQTSY      1 - 70
VESSPCQTSCYRPRTSLLCSPCKTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGVRSLGYGSCGFPSL     71 - 140
GYGSGFCRPTYLASRSCQSPCYRPAYGSTFCRSTC                                       141 - 175
//

Text Mined References (4)

PMID Year Title