Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.2e-10
medulloblastoma, large-cell 6241 1.8e-04
adult high grade glioma 3801 2.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSY      1 - 70
VESSPCQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGFRSLGYGGCGFPSL     71 - 140
GYGVGFCRPTYLASRSCQSSCYRPTCGSGFYY                                          141 - 172
//

Text Mined References (4)

PMID Year Title