Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.5e-06

AA Sequence

MSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPVSRVSSPCCRVTCEPS      1 - 70
PCQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKTVCCKPVCCMPVCCGPSSSCCQQSSCQPA     71 - 140
CCISSPCQQSCCVPVCCKPICCVPVCSGASSLCCQQSSCQPACCTTSCCRPSSSVSLLCRPVCRPARRVP    141 - 210
VPSCCVPTSSCQPSCGRLASCGSLLCRPTCSRLAC                                       211 - 245
//

Text Mined References (5)

PMID Year Title