Property Summary

NCBI Gene PubMed Count 31
PubMed Score 183.63
PubTator Score 83.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.100 3.0e-02
malignant mesothelioma 4.100 2.7e-09
ovarian cancer 1.200 8.3e-06
psoriasis -1.500 9.4e-07
tuberculosis -1.700 3.2e-06

Gene RIF (10)

AA Sequence

MTCGSYCGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCGRSFGYRSGGV      1 - 70
CGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAFIDKVRFLEQQNKLLETKLQF     71 - 140
YQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASELNHVQEVLEGYKKKYEEEVSLRATAENEFVA    141 - 210
LKKDVDCAYLRKSDLEANVEALIQEIDFLRRLYEEEIRVLQSHISDTSVVVKLDNSRDLNMDCIIAEIKA    211 - 280
QYDDIVTRSRAEAESWYRSKCEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAV    281 - 350
AQSEQQGEAALSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG    351 - 420
VGSVNVCVSSSRGGVVCGDLCASTTAPVVSTRVSSVPSNSNVVVGTTNACAPSARVGVCGGSCKRC        421 - 486
//

Text Mined References (31)

PMID Year Title