Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.67
PubTator Score 21.75

Knowledge Summary


No data available



Accession Q9NSB2 B2RA43 Q6ISB0 Q701L6
Symbols HB4


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

ACVPSVPCPLPTQGGFSSCSGGRSSSVRFVSTTTSCRTKY                                  561 - 600

Text Mined References (9)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
15737194 2005 Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10692104 2000 Characterization of a 300 kbp region of human DNA containing the type II hair keratin gene domain.
2431943 1986 The complement of native alpha-keratin polypeptides of hair-forming cells: a subset of eight polypeptides that differ from epithelial cytokeratins.