Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.56
PubTator Score 25.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.600 2.5e-03
non-small cell lung cancer 1.636 3.1e-12
interstitial cystitis -2.300 2.1e-04
cystic fibrosis -1.800 1.4e-04
non primary Sjogren syndrome sicca 1.100 1.9e-02
lung adenocarcinoma 2.200 2.5e-08
nasopharyngeal carcinoma -1.200 1.0e-04
spina bifida -2.153 3.3e-02
Breast cancer -1.100 1.3e-04
invasive ductal carcinoma 1.400 1.8e-02

Gene RIF (1)

PMID Text
20843789 Alternative splice variants, K80 and K80.1 distribute differently in epithelia of hair and skin.

AA Sequence

MACRSCVVGFSSLSSCEVTPVGSPRPGTSGWDSCRAPGPGFSSRSLTGCWSAGTISKVTVNPGLLVPLDV      1 - 70
KLDPAVQQLKNQEKEEMKALNDKFASLIGKVQALEQRNQLLETRWSFLQGQDSAIFDLGHLYEEYQGRLQ     71 - 140
EELRKVSQERGQLEANLLQVLEKVEEFRIRYEDEISKRTDMEFTFVQLKKDLDAECLHRTELETKLKSLE    141 - 210
SFVELMKTIYEQELKDLAAQVKDVSVTVGMDSRCHIDLSGIVEEVKAQYDAVAARSLEEAEAYSRSQLEE    211 - 280
QAARSAEYGSSLQSSRSEIADLNVRIQKLRSQILSVKSHCLKLEENIKTAEEQGELAFQDAKTKLAQLEA    281 - 350
ALQQAKQDMARQLRKYQELMNVKLALDIEIATYRKLVEGEEGRMDSPSATVVSAVQSRCKTAASRSGLSK    351 - 420
APSRKKKGSKGPVIKITEMSEKYFSQESEVSE                                          421 - 452
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24465473 2014 A genome-wide association study identifies a locus on TERT for mean telomere length in Han Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20843789 2010 Against the rules: human keratin K80: two functional alternative splice variants, K80 and K80.1, with special cellular localization in a wide range of epithelia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16831889 2006 New consensus nomenclature for mammalian keratins.
15737194 2005 Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.