Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.95
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 2.2e-10
psoriasis 6685 6.0e-07
nasopharyngeal carcinoma 1056 1.8e-04
spina bifida 1064 4.9e-02
Disease Target Count Z-score Confidence
Eosinophilic esophagitis 31 3.067 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
nasopharyngeal carcinoma -1.400 1.8e-04
psoriasis 1.700 6.0e-07
spina bifida -1.933 4.9e-02
ovarian cancer 1.200 2.2e-10

Synonym

Accession Q8N1N4 A8K4D6 Q5HYM7 Q7RTT2
Symbols K5B
K78
Kb40
CK-78

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
26340985 K78 is strongly expressed in the basal and parabasal cell layers with decreasing intensity in the lower suprabasal cells of keratinising and non-keratinising squamous epithelia and keratinocyte cultures.

AA Sequence

MSLSPCRAQRGFSARSACSARSRGRSRGGFSSRGGFSSRSLNSFGGCLEGSRGSTWGSGGRLGVRFGEWS      1 - 70
GGPGLSLCPPGGIQEVTINQNLLTPLKIEIDPQFQVVRTQETQEIRTLNNQFASFIDKVRFLEQQNKVLE     71 - 140
TKWHLLQQQGLSGSQQGLEPVFEACLDQLRKQLEQLQGERGALDAELKACRDQEEEYKSKYEEEAHRRAT    141 - 210
LENDFVVLKKDVDGVFLSKMELEGKLEALREYLYFLKHLNEEELGQLQTQASDTSVVLSMDNNRYLDFSS    211 - 280
IITEVRARYEEIARSSKAEAEALYQTKYQELQVSAQLHGDRMQETKVQISQLHQEIQRLQSQTENLKKQN    281 - 350
ASLQAAITDAEQRGELALKDAQAKVDELEAALRMAKQNLARLLCEYQELTSTKLSLDVEIATYRRLLEGE    351 - 420
ECRMSGECTSQVTISSVGGSAVMSGGVGGGLGSTCGLGSGKGSPGSCCTSIVTGGSNIILGSGKDPVLDS    421 - 490
CSVSGSSAGSSCHTILKKTVESSLKTSITY                                            491 - 520
//

Text Mined References (16)

PMID Year Title
26340985 2016 Localisation of keratin K78 in the basal layer and first suprabasal layers of stratified epithelia completes expression catalogue of type II keratins and provides new insights into sequential keratin expression.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15737194 2005 Characterization of new members of the human type II keratin gene family and a general evaluation of the keratin gene domain on chromosome 12q13.13.
15085952 2004 Comprehensive analysis of keratin gene clusters in humans and rodents.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11792552 2002 'Hard' and 'soft' principles defining the structure, function and regulation of keratin intermediate filaments.
11683385 2001 Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18.
10692104 2000 Characterization of a 300 kbp region of human DNA containing the type II hair keratin gene domain.
2433356 1987 Polymorphic keratins in human epidermis.