Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.14
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.2e-10
psoriasis 6694 5.8e-07
nasopharyngeal carcinoma 1058 1.8e-04
spina bifida 1074 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
nasopharyngeal carcinoma -1.400 1.8e-04
ovarian cancer 1.200 2.2e-10
psoriasis 1.300 5.8e-07
spina bifida -1.933 4.9e-02

Gene RIF (1)

AA Sequence

MSLSPCRAQRGFSARSACSARSRGRSRGGFSSRGGFSSRSLNSFGGCLEGSRGSTWGSGGRLGVRFGEWS      1 - 70
GGPGLSLCPPGGIQEVTINQNLLTPLKIEIDPQFQVVRTQETQEIRTLNNQFASFIDKVRFLEQQNKVLE     71 - 140
TKWHLLQQQGLSGSQQGLEPVFEACLDQLRKQLEQLQGERGALDAELKACRDQEEEYKSKYEEEAHRRAT    141 - 210
LENDFVVLKKDVDGVFLSKMELEGKLEALREYLYFLKHLNEEELGQLQTQASDTSVVLSMDNNRYLDFSS    211 - 280
IITEVRARYEEIARSSKAEAEALYQTKYQELQVSAQLHGDRMQETKVQISQLHQEIQRLQSQTENLKKQN    281 - 350
ASLQAAITDAEQRGELALKDAQAKVDELEAALRMAKQNLARLLCEYQELTSTKLSLDVEIATYRRLLEGE    351 - 420
ECRMSGECTSQVTISSVGGSAVMSGGVGGGLGSTCGLGSGKGSPGSCCTSIVTGGSNIILGSGKDPVLDS    421 - 490
CSVSGSSAGSSCHTILKKTVESSLKTSITY                                            491 - 520
//

Text Mined References (16)

PMID Year Title