Property Summary

NCBI Gene PubMed Count 88
PubMed Score 1303.76
PubTator Score 937.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -5.700 8.2e-10
psoriasis -2.000 1.7e-05
cystic fibrosis 1.198 5.2e-05
pancreatic ductal adenocarcinoma liver m... 3.826 1.0e-02
non-small cell lung cancer -1.632 8.8e-06
X-linked cerebral adrenoleukodystrophy 2.800 2.4e-02
lung cancer -2.300 3.7e-05
active ulcerative colitis 2.055 3.7e-02
pancreatic cancer 3.000 6.2e-07
interstitial cystitis -3.100 1.7e-02
nasopharyngeal carcinoma -2.000 8.0e-04
Endometriosis -1.295 1.5e-02
lung carcinoma -2.900 4.0e-29
Breast cancer -1.300 1.2e-02
ductal carcinoma in situ 2.900 1.2e-02
ovarian cancer 3.000 4.4e-04
pituitary cancer -1.800 1.2e-02

 GO Process (1)

Gene RIF (65)

PMID Text
26670478 K7 expression was also detected in 72 of 75 triple-negative carcinoma cases
26551618 Cytokeratin 7 positivity in cervical low-grade squamous intraepithelial lesion is a marker for risk of progression to a high-grade lesion.
26469326 CK7, TTF-1 and napsin A are predominantly expressed in primary lung adenocarcinoma patients, with CDX-2 being inconsistently expressed.
26366614 Immunostaining for CK7 and epithelial membrane antigen can be used to differentiate interlobular bile ducts from ductular proliferation in patients with cholestasis.
26306784 Data show that cytokeratin-7 (KRT7) mRNA expression serves as a sensitive approach for the molecular detection of KRT7-positive circulating tumour cells (CTCs)-resembling A549 cells in peripheral whole blood.
25643514 The present study confirmed that CK14, but not CK20 or CK7, is expressed in urothelial carcinoma with squamous differentiation and squamous cell carcinoma of the urinary bladder.
25406900 Epithelial-mesenchymal transition-related proteins CK-7 and alpha-SMA colocalized to the intrahepatic biliary epithelial cells in patients with biliary atresia.
25076852 The immunofluorescent staining pattern of Wnt1 and CK7 as well as Wnt1 and CK13 was consistent with IHC results. Thus, in pleomorphic adenoma, Wnt is involved in tumor cell differentiation of peripheral columnar cells forming solid nests
25063315 There were differences between CK5/6, p63,CK34betaE12 and TTF-1 expression with tumor differentiation in squamous cell carcinoma or adenocarcinomas
24908142 BRAF-mutated microsatellite stable colorectal carcinoma often displays reduced CDX2 and increased CK7 expression
24403459 Loss of cytokeratin 7 is associated with reduced response to concommitant radiochemotherapy for locally advanced cervical cancer.
23887291 Our results suggested that a combination of CK7 and TP53 immunohistochemistry may be helpful in diagnosing inflammatory bowel disease-associated dysplasia in difficult cases.
23590728 CK7 and Cam 5.2 expression may occur in SCC. A panel including Ber-Ep4 is advisable for immunohistochemical differentiation of EPD from SCC.
23434146 Of the cases of clear cell renal carcinoma there was immunoreactivity for alpha-methylacyl-CoA racemase and strong diffuse immuno-positivity for cytokeratin.
22895272 Pouch/peripouch and UC-associated adenocarcinoma had a comparable positive rate for CK7, CK20, and CDX2 by immunohistochemistry.
22748158 CK7 staining was notably heterogeneous, with 14.5% of all cases demonstrating </=20% tumour cell staining
22716237 CK7 + centrilobular hepatocytes occur relatively frequently in non-neoplastic liver disease, associated with centrilobular scarring and CK7-positive periportal hepatocytes, and appear to be a non-specific phenomenon of underlying disease.
22390404 Heterogeneity of cytokeratin 7 expression in pagetoid Bowen's disease.
22382985 None of the Wilms' tumors-associated lesions were positive for KRT7, but 69-80% of lesions associated with pRCpapillary renal cell tumors and mucinous tubular and spindle cell carcinomas were positive for KRT7.
22361037 This is the first reported study of the relationship between CK20/CK7 immunophenotype, BRAF mutations and microsatellite status in colorectal carcinomas
22268990 Both the CK7-/CK20+ phenotype and expression of the antibody CDX2 are highly specific and sensitive markers of colorectal origin.
22203179 High Cytokeratin-7 is associated with esophageal squamous cell carcinoma.
22119824 The expressions of CK7 and CK20 in nasal polyps were analyzed.
21884201 Aberrant expression of K7 in budding cancer cells represents a modification of the epithelial phenotype ('epithelial-epithelial transition': EET) which may be linked to gains in motility and invasive potential.
21681009 CK-7 expression grades correlated positively with histological stages of primary biliary cirrhosis (r=0.639, P<0.000) and negatively with granulomas (r=-0.432, P<0.0001; OR=0.173, P=0.0011).
21574103 Our results along with the data from the literature indicate that CK7/CK20 expression may be of clinical significance.
21358552 Our results reveal that menopause influences the adipose tissue expression of many genes, especially of neurexin 3, metallothionein 1E, and keratyn 7, which are associated with the alteration of several key biological processes.
21282015 A considerable number of colorectal carcinomas showed immunoreactivity to CK7.
21228364 Hepatocyte CK7 expression is frequently noted in chronic allograft rejection, and it would appear to reflect ductopenia.
20727680 Case Report: Primary pulmonary adenocarcinoma with enteric differentiation resembling metastatic colorectal carcinoma, negative for cytokeratin 7.
20574624 Case Report: CK7+/CK20- Merkel cell carcinoma presenting as inguinal subcutaneous nodules with subsequent epidermotropic metastasis.
20557372 Endometrial adenocarcinomas show micro-anatomical variations in Ki67 expression and this is often inversely correlated with CK7 immunoreactivity.
20538416 Immunohistochemistry for cytokeratins 7 and 19, which mark biliary epithelium, is helpful in the diagnosis of biliary diseases.
20398190 the expression of Cytokeratins 7, 8, 18, and 19 may serve as differential diagnostic markers for pulmonary large cell neuroendocrine carcinoma and small cell lung carcinoma
20043065 FOXA1 induces not only KRT7 but also LOXL2 in a subset of poor prognostic esophageal squamous cell carcinomas with metastatic lymph nodes
20001343 Toker cells and mammmary Paget cells share immunoreactivity to CK7.
19614771 The presence of microcystic, elongated and fragmented ('MELF') gland invasion was characterized by strong CK7 expression, sometimes in contrast to adjacent unstained tumour glands.
19601945 Unlike Paget's disease, breast Toker cells have small bland nuclei and are characterized by CK7 positivity.
19419944 There was a significant difference between AP, CK 7 and CK 8 expressions in primary lung adenocarcinomas (P=0.02; Chi-squared test).
19396034 expression of KRT7 might help to explain the pathological, reflux-related nature of columnar-lined esophagus, as aberrant expression in a very early stage of the multistep Barrett esophagus progression
19302533 the combination of CK7, S100A1 and claudin 8 immunohistochemistry can be useful for classifying tumours of overlapping histology as chromophobe renal cell carcinoma or renal oncocytomas.
19157505 cytokeratins 7 and 19, are very helpful in distinguishing normal from lesional tissue, as well as hepatic adenoma from focal nodular hyperplasia
19098678 It can be helpful in cases with metastatic rectal carcinoma, especially those with CK7+/CK20+ or CK20-/CK7- immunophenotype.
19032382 Human eccrine sweat glands express CK7, CK8, CK14, CK18, CK19, CEA, EMA, Ki67, p63, EGF and EGFR. In skin, CEA can be used as a specific immunological marker of sweat glands.
18949396 CK7 expression was a useful biomarker for predicting the outcome of stage I/IIA/IIB Squamous cell carcinoma of the esophagus
18936968 CK7, bax, CCND1, and HER2 represent marker proteins and frequently amplified genes in carcinomas of the ampulla of Vater.
18604734 Clear cell renal cell carcinoma characterised by diffuse CK7 positivity represents a distinct type of CRCC with characteristic histopathological and immunohistochemical features
18602664 Distinct cytokeratin 7, cytokeratin 19, & neuronal cell adhesion molecule staining patterns are seen in hepatic adenoma & focal nodular hyperplasia possibly suggest activation of different subsets of hepatic progenitor/stem cell.
18478571 The variability of CK expression in clear cell renal cell carcinoma (ccRCC) can be explained by genetic heterogeneity. The CK7/CK19 expressing subtype is associated with better outcome.
18317225 In ovarian metastases from undiagnosed colorectal adenocarcinomas, elevated CA-125 levels and frequent coexpression of cytokeratin 7 are features that can contribute to misclassification of these metastases as primary ovarian neoplasms.
18092953 Possible relationship between expression of CK7 and CK20 and neoplastic development of colorectal mucosa in patients with ulcerative colitis.
18042078 an immunohistochemical panel including CK7,CD10 and mesothelin is optimal for distinguishing between ovarian and renal clear cell carcinoma.
17715023 CK7 is a possible marker for colorectal carcinogenesis.
17593078 salivary gland neoplasms showed a CK7+/CK20- immunoprofile ranging from 5 to 100%; squamous carcinoma showed negative CK7/20 immunoexpression
16879391 Results showed that 28% of hepatocellular carcinomas contained cells expressing CK7.
16483709 In peripheral blood mononuclear cells, sarcolectin induced CD4+ T cell growth and expression of inflammatory cytokine genes, including TNF-alpha, IL-1beta, IL-6 and IL-8
15894926 expressed in sinonasal intestinal-type adenocarcinoma less frequently than in colonic adenocarcinoma
15502805 Cytokeratin 7 was found in the majority of type 1 papillary renal cell carcinomas and chromophobe renal cell carcinomas.
15489654 Cytokeratin 7 and epithelial membrane antigen are essentially negative in yolk sac tumors but are diffusely positive in clear cell carcinomas and endometriod adenocarcinomas making them useful markers for differentiating YSTs from both CCCs and EACs.
15371952 Alteration of CK7 and CK20 expression profile that occurs early in small intestinal tumorigenesis.
14631371 The combined expression of CK7 and CK20 has a low specificity in the distinction between esophageal and cardiac (stomach) adenocarcinomas.
14513050 altered expression and transcription of SCL in patients' hematopoietic cells emphasizes the possible contribution of this regulatory nuclear factor to the hematopoietic dysregulation, which is a feature of myelofibrosis with myeloid metaplasia
12359226 cloning and expression of the gene
12072504 HPV16 E7 mRNA-cytokeratin 7 binding in squamous cervical cancer SiHa cells occurs through the 6-mer peptide SEQIKA present in human cytokeratin 7 protein
11962749 Changing pattern of cytokeratin 7 and 20 expression from normal epithelium to intestinal metaplasia of the gastric mucosa and gastroesophageal junction

AA Sequence

MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQ      1 - 70
SLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDI     71 - 140
FEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINHRTAAENEFVVLKKDVDAAYMSKVE    141 - 210
LEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAE    211 - 280
AWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDA    281 - 350
RAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTG    351 - 420
GSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD                         421 - 469
//

Text Mined References (97)

PMID Year Title
26670478 2016 Aberrant keratin 7 and 20 expression in triple-negative carcinoma of the breast.
26551618 2016 Predictive Value of Cytokeratin 7 Immunohistochemistry in Cervical Low-grade Squamous Intraepithelial Lesion as a Marker for Risk of Progression to a High-grade Lesion.
26469326 2016 CDX-2 Expression in Primary Lung Adenocarcinoma.
26366614 Identification of Bile Duct Paucity in Alagille Syndrome: Using CK7 and EMA Immunohistochemistry as a Reliable Panel for Accurate Diagnosis.
26306784 2015 Prognostic value of cytokeratin-7 mRNA expression in peripheral whole blood of advanced lung adenocarcinoma patients.
25643514 2014 Expression of cytokeratin 7, 20, 14 in urothelial carcinoma and squamous cell carcinoma of the Egyprian urinary bladder cancer.
25406900 2015 The expression of epithelial-mesenchymal transition-related proteins in biliary epithelial cells is associated with liver fibrosis in biliary atresia.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25076852 2014 Wnt signaling as a possible promoting factor of cell differentiation in pleomorphic adenomas.
25063315 2014 Analysis of clinical characteristics and differential diagnosis of the lung biopsy specimens in 99 adenocarcinoma cases and 111 squamous cell carcinoma cases: utility of an immunohistochemical panel containing CK5/6, CK34?E12, p63, CK7 and TTF-1.
24908142 2014 BRAF-mutated microsatellite stable colorectal carcinoma: an aggressive adenocarcinoma with reduced CDX2 and increased cytokeratin 7 immunohistochemical expression.
24403459 2014 Cytokeratin 7 as a predictive factor for response to concommitant radiochemotherapy for locally advanced cervical cancer: a preliminary study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23887291 2014 Diagnostic utility of TP53 and cytokeratin 7 immunohistochemistry in idiopathic inflammatory bowel disease-associated neoplasia.
23590728 2013 Expression of CK7, Cam 5.2 and Ber-Ep4 in cutaneous squamous cell carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23434146 2013 Renal cell carcinoma with areas mimicking renal angiomyoadenomatous tumor/clear cell papillary renal cell carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895272 2012 Histomorphologic and molecular features of pouch and peripouch adenocarcinoma: a comparison with ulcerative colitis-associated adenocarcinoma.
22748158 2012 Cytokeratin 7: a re-evaluation of the 'tried and true' in triple-negative breast cancers.
22716237 2012 Aberrant cytokeratin 7 expression of centrilobular hepatocytes: a clinicopathological study.
22390404 2012 Heterogeneity of cytokeratin 7 expression in pagetoid Bowen's disease.
22382985 2012 Expression of KRT7 and WT1 differentiates precursor lesions of Wilms' tumours from those of papillary renal cell tumours and mucinous tubular and spindle cell carcinomas.
22361037 2012 Aberrant pattern of the cytokeratin 7/cytokeratin 20 immunophenotype in colorectal adenocarcinomas with BRAF mutations.
22268990 2012 The value of CDX2 and cytokeratins 7 and 20 expression in differentiating colorectal adenocarcinomas from extraintestinal gastrointestinal adenocarcinomas: cytokeratin 7-/20+ phenotype is more specific than CDX2 antibody.
22203179 2012 Cytokeratin 7 is a predictive marker for survival in patients with esophageal squamous cell carcinoma.
22119824 2011 Expression pattern of CK7 and CK20 in nasal polyps, at patients with chronic rhinosinusitis with nasal polyposis.
21884201 2011 Keratin 7 expression in colorectal cancer--freak of nature or significant finding?
21681009 2011 Expression of cytokeratin 7 as a histological marker of cholestasis and stages of primary biliary cirrhosis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21574103 2011 Cytokeratin 7 and 20 expression in gallbladder carcinoma.
21358552 2011 Profile of adipose tissue gene expression in premenopausal and postmenopausal women: site-specific differences.
21282015 2011 Cytokeratin 7 and cytokeratin 20 expression in colorectal adenocarcinomas.
21269460 2011 Initial characterization of the human central proteome.
21228364 2011 Hepatocyte cytokeratin 7 expression in chronic allograft rejection.
21149639 2011 G protein-coupled estrogen receptor 1/G protein-coupled receptor 30 localizes in the plasma membrane and traffics intracellularly on cytokeratin intermediate filaments.
20727680 2011 Primary pulmonary adenocarcinoma with enteric differentiation resembling metastatic colorectal carcinoma: a report of the second case negative for cytokeratin 7.
20574624 2010 CK7+/CK20- Merkel cell carcinoma presenting as inguinal subcutaneous nodules with subsequent epidermotropic metastasis.
20557372 2010 Micro-anatomical variation in cellular proliferation in endometrial adenocarcinoma, and inverse correlation between Ki67 and cytokeratin 7 expression.
20538416 2010 Biliary cytokeratin expression but not CD56 (N-CAM) expression aids in the differential diagnosis of non-neoplastic bile duct diseases.
20398190 2010 Significant high expression of cytokeratins 7, 8, 18, 19 in pulmonary large cell neuroendocrine carcinomas, compared to small cell lung carcinomas.
20043065 2010 Forkhead box A1 transcriptional pathway in KRT7-expressing esophageal squamous cell carcinomas with extensive lymph node metastasis.
20001343 2009 Useful immunohistochemical markers for distinguishing Paget cells from Toker cells.
19614771 2009 Immunophenotypic features of MELF pattern invasion in endometrial adenocarcinoma: evidence for epithelial-mesenchymal transition.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19601945 Toker cells revisited.
19419944 2009 Alkaline phosphatase, cytokeratin 7, cytokeratin 8 in the diagnosis of primary lung adenocarcinoma from 148 pleura fluids specimens.
19396034 2009 Keratin 7 expression as an early marker of reflux-related columnar mucosa without intestinal metaplasia in the esophagus.
19302533 2009 Immunohistochemical stain for cytokeratin 7, S100A1 and claudin 8 is valuable in differential diagnosis of chromophobe renal cell carcinoma from renal oncocytoma.
19157505 2009 Diagnostic use of cytokeratins, CD34, and neuronal cell adhesion molecule staining in focal nodular hyperplasia and hepatic adenoma.
19098678 2009 CDX2, cytokeratins 7 and 20 immunoreactivity in rectal adenocarcinoma.
19032382 2009 Antigen expression of human eccrine sweat glands.
18949396 2008 Expression of cytokeratin 7 predicts survival in stage I/IIA/IIB squamous cell carcinoma of the esophagus.
18936968 2008 Immunophenotyping and oncogene amplifications in tumors of the papilla of Vater.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18604734 2008 Sporadic clear cell renal cell carcinoma with diffuse cytokeratin 7 immunoreactivity.
18602664 2008 Different cytokeratin and neuronal cell adhesion molecule staining patterns in focal nodular hyperplasia and hepatic adenoma and their significance.
18478571 2008 Association of cytokeratin 7 and 19 expression with genomic stability and favorable prognosis in clear cell renal cell cancer.
18317225 2008 Women with undiagnosed colorectal adenocarcinomas presenting with ovarian metastases: clinicopathologic features and comparison with women having known colorectal adenocarcinomas and ovarian involvement.
18092953 2007 Altered expression of CK7 and CK20 in preneoplastic and neoplastic lesions in ulcerative colitis.
18042078 2007 Diagnostic value of cytokeratin 7, CD10 and mesothelin in distinguishing ovarian clear cell carcinoma from metastasis of renal clear cell carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17715023 2007 [Clinicopathological implications of positive CK7 expression in colorectal carcinoma].
17593078 2007 CK7+/CK20- immunoexpression profile is typical of salivary gland neoplasia.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16879391 2006 The clinicopathological and prognostic relevance of cytokeratin 7 and 19 expression in hepatocellular carcinoma. A possible progenitor cell origin.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16483709 2006 Effects of sarcolectin (SCL) on human peripheral blood mononuclear cells.
15894926 2005 Expression of CDX2, cytokeratins 7 and 20 in sinonasal intestinal-type adenocarcinoma.
15782174 2004 Identifying and quantifying in vivo methylation sites by heavy methyl SILAC.
15502805 2005 Expression of aquaporins and PAX-2 compared to CD10 and cytokeratin 7 in renal neoplasms: a tissue microarray study.
15489654 2004 The use of cytokeratin 7 and EMA in differentiating ovarian yolk sac tumors from endometrioid and clear cell carcinomas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371952 2004 Alteration of cytokeratin 7 and cytokeratin 20 expression profile is uniquely associated with tumorigenesis of primary adenocarcinoma of the small intestine.
14631371 2004 Identical cytokeratin expression pattern CK7+/CK20- in esophageal and cardiac cancer: etiopathological and clinical implications.
14513050 2003 Altered transcription of the stem cell leukemia gene in myelofibrosis with myeloid metaplasia.
12577067 2003 A proteomics strategy to elucidate functional protein-protein interactions applied to EGF signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359226 2002 Cloning of human, murine, and marsupial keratin 7 and a survey of K7 expression in the mouse.
12072504 2002 Translational regulation of human papillomavirus type 16 E7 mRNA by the peptide SEQIKA, shared by rabbit alpha(1)-globin and human cytokeratin 7.
11962749 2002 Changing pattern of cytokeratin 7 and 20 expression from normal epithelium to intestinal metaplasia of the gastric mucosa and gastroesophageal junction.
11888936 2002 Nucleophosmin-anaplastic lymphoma kinase (NPM-ALK), a novel Hsp90-client tyrosine kinase: down-regulation of NPM-ALK expression and tyrosine phosphorylation in ALK(+) CD30(+) lymphoma cells by the Hsp90 antagonist 17-allylamino,17-demethoxygeldanamycin.
11840567 2002 Cluster analysis of an extensive human breast cancer cell line protein expression map database.
11169732 2001 Molecular interaction between human tumor marker protein p150, the largest subunit of eIF3, and intermediate filament protein K7.
10492017 1999 Sarcolectin (SCL): structure and expression of the recombinant molecule.
9734130 1998 [Mucinous adenocarcinoma of the urachus synchronic with colorectal adenocarcinoma. Value of immunohistochemistry in the differential diagnosis].
9614373 1998 Cytokeratins and cell differentiation in the pancreas.
8895530 1996 A pancreatic cancer-specific expression profile.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2459129 1988 Isolation, sequence, and differential expression of a human K7 gene in simple epithelial cells.
2436934 1987 Tissue distribution of keratin 7 as monitored by a monoclonal antibody.
2415537 1985 Sequence and expression of a human type II mesothelial keratin.
1713141 1991 Three epidermal and one simple epithelial type II keratin genes map to human chromosome 12.