Property Summary

NCBI Gene PubMed Count 17
PubMed Score 107.62
PubTator Score 63.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -3.600 3.5e-02
psoriasis 3.100 7.6e-105
cutaneous lupus erythematosus 2.200 3.6e-06
non-small cell lung cancer 5.098 2.5e-12
intraductal papillary-mucinous neoplasm ... 6.000 5.4e-04
active Crohn's disease 3.358 7.1e-05
ulcerative colitis 3.900 3.7e-05
pancreatic cancer 1.800 1.5e-02
cystic fibrosis 2.800 5.5e-07
Breast cancer -4.700 5.3e-12
breast carcinoma -1.400 1.8e-07
spina bifida -1.890 5.0e-02
ductal carcinoma in situ 2.100 3.0e-02
ovarian cancer 1.200 2.9e-05

Gene RIF (4)

PMID Text
26464664 These results suggested that the upregulation of notch1 and KRT6B might be involved in the development, progression and prognosis of human renal cell carcinoma
23075894 Data show that calretinin and CK5/6 were positive in 100 and 64% of mesotheliomas, and 92 and 31% of reactive effusions, respectively, and desmin was negative in all malignant cases and positive in 85% of reactive effusions.
22264670 We found that the KRT16 mutation carriers developed plantar keratoderma at a similar age to KRT6a carriers wheras KRT6B and KRT17 carriers were significantly more likely to report later onset.
19720911 Studies show that the intrinsic molecular signature of five markers, ER, PR, HER-2, CK 5/6, and EGFR, demonstrated specificity of 100% and sensitivity of 75%, compared with classification by gene expression profiling.

AA Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRI      1 - 70
SIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTV     71 - 140
NQSLLTPLNLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNL    141 - 210
EPLFEQYINNLRRQLDNIVGERGRLDSELRNMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMN    211 - 280
KVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA    281 - 350
EAESWYQTKYEELQITAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL    351 - 420
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQ    421 - 490
STVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRATGGGLSSVGGGSSTIKYTTTSSSSRK    491 - 560
SYKH                                                                      561 - 564
//

Text Mined References (20)

PMID Year Title
26464664 2015 KRT6 interacting with notch1 contributes to progression of renal cell carcinoma, and aliskiren inhibits renal carcinoma cell lines proliferation in vitro.
25416956 2014 A proteome-scale map of the human interactome network.
23075894 2012 The diagnostic utility of D2-40, calretinin, CK5/6, desmin and MOC-31 in the differentiation of mesothelioma from adenocarcinoma in pleural effusion cytology.
22264670 2012 A review of the clinical phenotype of 254 patients with genetically confirmed pachyonychia congenita.
21326300 2011 A large mutational study in pachyonychia congenita.
19720911 2009 Prediction of local recurrence, distant metastases, and death after breast-conserving therapy in early-stage invasive breast cancer using a five-biomarker panel.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
16250206 2005 The genetic basis of pachyonychia congenita.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9618173 1998 A mutation in human keratin K6b produces a phenocopy of the K17 disorder pachyonychia congenita type 2.
7543104 1995 Cloning and characterization of multiple human genes and cDNAs encoding highly related type II keratin 6 isoforms.
2470667 1989 Two type II keratin genes are localized on human chromosome 12.
2410904 1985 The sequence of a type II keratin gene expressed in human skin: conservation of structure among all intermediate filament genes.
1713141 1991 Three epidermal and one simple epithelial type II keratin genes map to human chromosome 12.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.
1284199 Squamous cell carcinomas, an immunohistochemical and ultrastructural study.