Property Summary

NCBI Gene PubMed Count 41
PubMed Score 80.60
PubTator Score 148.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Atopic dermatitis 1.900 8.8e-04
cutaneous lupus erythematosus 2.400 2.8e-04
esophageal adenocarcinoma -4.900 2.3e-02
lung cancer 3.800 3.4e-04
nasopharyngeal carcinoma -1.900 2.1e-02
non-small cell lung cancer 5.849 2.4e-15
osteosarcoma 1.085 1.1e-05
pancreatic cancer 2.000 3.7e-03
psoriasis 1.700 1.6e-06
spina bifida -1.900 4.3e-02
ulcerative colitis 2.100 1.1e-02

Gene RIF (19)

AA Sequence

MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSVSVSRSRGSGGLGGACGGAGFGSRSLYGLGGSKRI      1 - 70
SIGGGSCAISGGYGSRAGGSYGFGGAGSGFGFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTV     71 - 140
NQSLLTPLNLQIDPTIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWTLLQEQGTKTVRQNL    141 - 210
EPLFEQYINNLRRQLDSIVGERGRLDSELRGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMN    211 - 280
KVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRA    281 - 350
EAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMAL    351 - 420
KDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQ    421 - 490
STVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRK    491 - 560
SYKH                                                                      561 - 564
//

Text Mined References (48)

PMID Year Title