Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.93
PubTator Score 21.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.1e-11

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 2.1e-11

Synonym

Accession O76013 Q86XG4
Symbols HA6
hHa6
KRTHA6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MATQTCTPTFSTGSIKGLCGTAGGISRVSSIRSVGSCRVPSLAGAAGYISSARSGLSGLGSCLPGSYLSS      1 - 70
ECHTSGFVGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAELESRIQEWYEFQIPYICPDY     71 - 140
QSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDFRTKYETELSLRQLVEADINGLRRILDELTLCK    141 - 210
ADLEAQVESLKEELMCLKKNHEEEVSVLRCQLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDV    211 - 280
EAWFNTQTEELNQQVVSSSEQLQCCQTEIIELRRTVNALEIELQAQHSMRNSLESTLAETEARYSSQLAQ    281 - 350
MQCLISNVEAQLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRHLLEGEDCKLPPQPCATACKPVIRVP    351 - 420
SVPPVPCVPSVPCTPAPQVGTQIRTITEEIRDGKVISSREHVQSRPL                           421 - 467
//

Text Mined References (10)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16831889 2006 New consensus nomenclature for mammalian keratins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
9756910 1998 Characterization of a 190-kilobase pair domain of human type I hair keratin genes.
7979242 1994 Intermediate filaments: structure, dynamics, function, and disease.
7686952 1993 Human hair keratins.