Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1.02
PubTator Score 1.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.5e-05
diabetes mellitus 1728 1.8e-03
Atopic dermatitis 952 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alopecia 115 3.437 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -1.100 4.1e-02
diabetes mellitus 1.200 1.8e-03
psoriasis -1.400 5.5e-05

Synonym

Accession Q14525 O76010
Symbols K33B
HA3II
Ha-3II
KRTHA3A
KRTHA3B
hHa3-II

Gene

  Ortholog (1)

Species Source Disease
Inparanoid OMA

AA Sequence

MPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASY      1 - 70
LEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILCSKSENARLVVQIDNAKLAADD     71 - 140
FRTKYQTEQSLRQLVESDINSLRRILDELTLCRSDLEAQMESLKEELLSLKQNHEQEVNTLRCQLGDRLN    141 - 210
VEVDAAPAVDLNQVLNETRNQYEALVETNRREVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVN    211 - 280
ALEIELQAQHNLRYSLENTLTESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE    281 - 350
CEINTYRSLLESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCNTFGY                    351 - 404
//

Text Mined References (18)

PMID Year Title