Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.37
PubTator Score 28.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.300 4.4e-03
lung cancer 3.500 1.6e-06
non-small cell lung cancer 1.298 4.0e-04
psoriasis -1.700 2.2e-02
subependymal giant cell astrocytoma -1.322 1.1e-02

Gene RIF (1)

AA Sequence

MPYNFCLPSLSCRTSCSSRPCVPPSCHSCTLPGACNIPANVSNCNWFCEGSFNGSEKETMQFLNDRLASY      1 - 70
LEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILCTKSENARLVVQIDNAKLAADD     71 - 140
FRTKYQTELSLRQLVESDINGLRRILDELTLCKSDLEAQVESLKEELLCLKSNHEQEVNTLRCQLGDRLN    141 - 210
VEVDAAPTVDLNRVLNETRSQYEALVETNRREVEQWFTTQTEELNKQVVSSSEQLQSYQAEIIELRRTVN    211 - 280
ALEIELQAQHNLRDSLENTLTESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLE    281 - 350
CEINTYRSLLESEDCNLPSNPCATTNACSKPIGPCLSNPCTSCVPPAPCTPCAPRPRCGPCNSFVR        351 - 416
//

Text Mined References (19)

PMID Year Title