Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.92
PubTator Score 40.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6514 1.5e-07
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 1.5e-07

Synonym

Accession Q7Z3Y8
Symbols KRT25C
K25IRS3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSVRFSSTSRRLGSCGGTGSVRLSSGGAGFGAGNTCGVPGIGSGFSCAFGGSSSAGGYGGGLGGGSASCA      1 - 70
AFTGNEHGLLSGNEKVTMQNLNDRLASYLENVRALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFP     71 - 140
IIDELKNQIISATTSNAHVVLQNDNARLTADDFRLKFENELALHQSVEADINGLRRVLDELTLCRTDLEI    141 - 210
QLETLSEELAYLKKNHEEEMKALQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFN    211 - 280
EKSASLQQQISDDAGATTSARNELIEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQI    281 - 350
GALEEQLHQVRTETEGQKLEYEQLLDIKVHLEKEIETYCLLIDGEDGSCSKSKGYGGPGNQTKDSSKTTI    351 - 420
VKTVVEEIDPRGKVLSSRVHTVEEKSTKVNNKNEQRVSS                                   421 - 459
//

Text Mined References (8)

PMID Year Title