Property Summary

NCBI Gene PubMed Count 19
PubMed Score 33.16
PubTator Score 33.76

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -3.154 5.0e-04
Atopic dermatitis -1.700 3.3e-05
intraductal papillary-mucinous neoplasm ... 2.100 2.9e-02
colon cancer 2.700 2.6e-02
lung cancer 2.000 1.2e-04
pancreatic cancer 1.900 3.8e-03
nasopharyngeal carcinoma -2.600 3.5e-06
Endometriosis -1.334 2.2e-02
spina bifida -2.693 3.0e-02
Breast cancer -3.100 2.7e-08
ovarian cancer 2.300 3.1e-04

Gene RIF (9)

PMID Text
24039993 Data show that Keratin23 (KRT23) knockdown affected molecules of the cell cycle and DNA replication, recombination and repair.
23682078 Increased expression of KRT23 is associated with colorectal cancer.
21492476 Data suggest a regulatory circuitry involving Smad4 dependent up-regulation of KRT23 (directly or indirectly) which in turn modulates the interaction between KRT23 and 14-3-3epsilon leading to a cytoplasmic sequestration of 14-3-3epsilon.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19383294 Keratin23 expression is a novel and important difference between microsatellite-stable and microsatellite-instable colon cancers.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
15081423 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNSGHSFSQTPSASFHGAGGGWGRPRSFPRAPTVHGGAGGARISLSFTTRSCPPPGGSWGSGRSSPLLGG      1 - 70
NGKATMQNLNDRLASYLEKVRALEEANMKLESRILKWHQQRDPGSKKDYSQYEENITHLQEQIVDGKMTN     71 - 140
AQIILLIDNARMAVDDFNLKYENEHSFKKDLEIEVEGLRRTLDNLTIVTTDLEQEVEGMRKELILMKKHH    141 - 210
EQEMEKHHVPSDFNVNVKVDTGPREDLIKVLEDMRQEYELIIKKKHRDLDTWYKEQSAAMSQEAASPATV    211 - 280
QSRQGDIHELKRTFQALEIDLQTQYSTKSALENMLSETQSRYSCKLQDMQEIISHYEEELTQLRHELERQ    281 - 350
NNEYQVLLGIKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGRLVLCQVNEIQK    351 - 420
HA                                                                        421 - 422
//

Text Mined References (21)

PMID Year Title
24039993 2013 Keratin23 (KRT23) knockdown decreases proliferation and affects the DNA damage response of colon cancer cells.
23682078 2013 Identification of putative immunologic targets for colon cancer prevention based on conserved gene upregulation from preinvasive to malignant lesions.
21492476 2011 Keratin 23, a novel DPC4/Smad4 target gene which binds 14-3-3?.
21269460 2011 Initial characterization of the human central proteome.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19383294 2007 Phosphoprotein Keratin 23 accumulates in MSS but not MSI colon cancers in vivo and impacts viability and proliferation in vitro.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
16831889 2006 New consensus nomenclature for mammalian keratins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15081423 2004 Single nucleotide polymorphisms associated with aggressive periodontitis and severe chronic periodontitis in Japanese.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12015898 2002 Cytoplasmic intermediate filaments are stably associated with nuclear matrices and potentially modulate their DNA-binding function.
11683385 2001 Genes for intermediate filament proteins and the draft sequence of the human genome: novel keratin genes and a surprisingly high number of pseudogenes related to keratin genes 8 and 18.
11135429 2001 Keratin 23 (K23), a novel acidic keratin, is highly induced by histone deacetylase inhibitors during differentiation of pancreatic cancer cells.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.